Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	402
Gene name	ARF like GTPase 2
Gene symbol	ARL2
Synonyms (NCBI Gene)	ARFL2MRCS1
Chromosome	11
Chromosome location	11q13.1
Summary	This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]

225

Show/Hide all (225)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001478	hsa-miR-16-5p	pSILAC	18668040
MIRT001478	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21199864
MIRT001478	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21199864
MIRT024965	hsa-miR-214-3p	Microarray;Other	19859982
MIRT001478	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT001478	hsa-miR-16-5p	Reporter assay;Microarray;Other	21199864
MIRT049673	hsa-miR-92a-3p	CLASH	23622248
MIRT037049	hsa-miR-877-3p	CLASH	23622248
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT053467	hsa-miR-195-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23807224
MIRT024965	hsa-miR-214-3p	Luciferase reporter assayqRT-PCRWestern blot	25621032
MIRT024965	hsa-miR-214-3p	Luciferase reporter assayqRT-PCRWestern blot	25621032
MIRT797653	hsa-miR-1252	CLIP-seq
MIRT797654	hsa-miR-1255a	CLIP-seq
MIRT797655	hsa-miR-1255b	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT797661	hsa-miR-4433	CLIP-seq
MIRT797662	hsa-miR-4459	CLIP-seq
MIRT797663	hsa-miR-4524	CLIP-seq
MIRT797664	hsa-miR-4662a-5p	CLIP-seq
MIRT797665	hsa-miR-4685-5p	CLIP-seq
MIRT797666	hsa-miR-4753-5p	CLIP-seq
MIRT797667	hsa-miR-4765	CLIP-seq
MIRT797668	hsa-miR-4768-3p	CLIP-seq
MIRT797669	hsa-miR-4778-3p	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797671	hsa-miR-503	CLIP-seq
MIRT797672	hsa-miR-513b	CLIP-seq
MIRT797673	hsa-miR-646	CLIP-seq
MIRT797653	hsa-miR-1252	CLIP-seq
MIRT797654	hsa-miR-1255a	CLIP-seq
MIRT797655	hsa-miR-1255b	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT797675	hsa-miR-2278	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT797677	hsa-miR-4508	CLIP-seq
MIRT797663	hsa-miR-4524	CLIP-seq
MIRT797678	hsa-miR-4660	CLIP-seq
MIRT797679	hsa-miR-4701-5p	CLIP-seq
MIRT797667	hsa-miR-4765	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797671	hsa-miR-503	CLIP-seq
MIRT797672	hsa-miR-513b	CLIP-seq
MIRT797680	hsa-miR-588	CLIP-seq
MIRT797673	hsa-miR-646	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq
MIRT1935638	hsa-miR-122	CLIP-seq
MIRT797654	hsa-miR-1255a	CLIP-seq
MIRT797655	hsa-miR-1255b	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT1935639	hsa-miR-4268	CLIP-seq
MIRT797663	hsa-miR-4524	CLIP-seq
MIRT797678	hsa-miR-4660	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797671	hsa-miR-503	CLIP-seq
MIRT797673	hsa-miR-646	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq
MIRT1935638	hsa-miR-122	CLIP-seq
MIRT2175693	hsa-miR-1236	CLIP-seq
MIRT797653	hsa-miR-1252	CLIP-seq
MIRT797654	hsa-miR-1255a	CLIP-seq
MIRT797655	hsa-miR-1255b	CLIP-seq
MIRT2175694	hsa-miR-1269	CLIP-seq
MIRT2175695	hsa-miR-1269b	CLIP-seq
MIRT2175696	hsa-miR-1288	CLIP-seq
MIRT2175697	hsa-miR-142-3p	CLIP-seq
MIRT2175698	hsa-miR-150	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT797675	hsa-miR-2278	CLIP-seq
MIRT2175699	hsa-miR-3126-5p	CLIP-seq
MIRT2175700	hsa-miR-3132	CLIP-seq
MIRT2175701	hsa-miR-3183	CLIP-seq
MIRT2175702	hsa-miR-345	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT2175703	hsa-miR-3649	CLIP-seq
MIRT2175704	hsa-miR-3661	CLIP-seq
MIRT2175705	hsa-miR-3690	CLIP-seq
MIRT2175706	hsa-miR-378	CLIP-seq
MIRT2175707	hsa-miR-378b	CLIP-seq
MIRT2175708	hsa-miR-378c	CLIP-seq
MIRT2175709	hsa-miR-378d	CLIP-seq
MIRT2175710	hsa-miR-378e	CLIP-seq
MIRT2175711	hsa-miR-378f	CLIP-seq
MIRT2175712	hsa-miR-378h	CLIP-seq
MIRT2175713	hsa-miR-378i	CLIP-seq
MIRT2175714	hsa-miR-422a	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT2175715	hsa-miR-4255	CLIP-seq
MIRT2175716	hsa-miR-4258	CLIP-seq
MIRT1935639	hsa-miR-4268	CLIP-seq
MIRT2175717	hsa-miR-4290	CLIP-seq
MIRT2175718	hsa-miR-4300	CLIP-seq
MIRT2175719	hsa-miR-4419a	CLIP-seq
MIRT797661	hsa-miR-4433	CLIP-seq
MIRT2175720	hsa-miR-4447	CLIP-seq
MIRT797662	hsa-miR-4459	CLIP-seq
MIRT2175721	hsa-miR-4472	CLIP-seq
MIRT2175722	hsa-miR-4510	CLIP-seq
MIRT2175723	hsa-miR-4515	CLIP-seq
MIRT797663	hsa-miR-4524	CLIP-seq
MIRT797678	hsa-miR-4660	CLIP-seq
MIRT797664	hsa-miR-4662a-5p	CLIP-seq
MIRT797665	hsa-miR-4685-5p	CLIP-seq
MIRT2175724	hsa-miR-4687-5p	CLIP-seq
MIRT797679	hsa-miR-4701-5p	CLIP-seq
MIRT2175725	hsa-miR-4723-3p	CLIP-seq
MIRT2175726	hsa-miR-4740-5p	CLIP-seq
MIRT2175727	hsa-miR-4743	CLIP-seq
MIRT797666	hsa-miR-4753-5p	CLIP-seq
MIRT797667	hsa-miR-4765	CLIP-seq
MIRT797668	hsa-miR-4768-3p	CLIP-seq
MIRT797669	hsa-miR-4778-3p	CLIP-seq
MIRT2175728	hsa-miR-492	CLIP-seq
MIRT2175729	hsa-miR-493	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797671	hsa-miR-503	CLIP-seq
MIRT797672	hsa-miR-513b	CLIP-seq
MIRT797680	hsa-miR-588	CLIP-seq
MIRT2175730	hsa-miR-619	CLIP-seq
MIRT2175731	hsa-miR-631	CLIP-seq
MIRT797673	hsa-miR-646	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq
MIRT2175732	hsa-miR-920	CLIP-seq
MIRT1935638	hsa-miR-122	CLIP-seq
MIRT2175693	hsa-miR-1236	CLIP-seq
MIRT797654	hsa-miR-1255a	CLIP-seq
MIRT797655	hsa-miR-1255b	CLIP-seq
MIRT2175697	hsa-miR-142-3p	CLIP-seq
MIRT2175698	hsa-miR-150	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT797675	hsa-miR-2278	CLIP-seq
MIRT2175700	hsa-miR-3132	CLIP-seq
MIRT2175701	hsa-miR-3183	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT2175715	hsa-miR-4255	CLIP-seq
MIRT2175716	hsa-miR-4258	CLIP-seq
MIRT1935639	hsa-miR-4268	CLIP-seq
MIRT2175717	hsa-miR-4290	CLIP-seq
MIRT2175718	hsa-miR-4300	CLIP-seq
MIRT797663	hsa-miR-4524	CLIP-seq
MIRT797678	hsa-miR-4660	CLIP-seq
MIRT2175724	hsa-miR-4687-5p	CLIP-seq
MIRT797679	hsa-miR-4701-5p	CLIP-seq
MIRT2175725	hsa-miR-4723-3p	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797671	hsa-miR-503	CLIP-seq
MIRT797680	hsa-miR-588	CLIP-seq
MIRT797673	hsa-miR-646	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq
MIRT2175732	hsa-miR-920	CLIP-seq
MIRT2175694	hsa-miR-1269	CLIP-seq
MIRT2175695	hsa-miR-1269b	CLIP-seq
MIRT2175696	hsa-miR-1288	CLIP-seq
MIRT2175697	hsa-miR-142-3p	CLIP-seq
MIRT2175698	hsa-miR-150	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT2175699	hsa-miR-3126-5p	CLIP-seq
MIRT2175700	hsa-miR-3132	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT2175703	hsa-miR-3649	CLIP-seq
MIRT2175704	hsa-miR-3661	CLIP-seq
MIRT2175705	hsa-miR-3690	CLIP-seq
MIRT2175706	hsa-miR-378	CLIP-seq
MIRT2175707	hsa-miR-378b	CLIP-seq
MIRT2175708	hsa-miR-378c	CLIP-seq
MIRT2175709	hsa-miR-378d	CLIP-seq
MIRT2175710	hsa-miR-378e	CLIP-seq
MIRT2175711	hsa-miR-378f	CLIP-seq
MIRT2175712	hsa-miR-378h	CLIP-seq
MIRT2175713	hsa-miR-378i	CLIP-seq
MIRT2175714	hsa-miR-422a	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT2175715	hsa-miR-4255	CLIP-seq
MIRT2175719	hsa-miR-4419a	CLIP-seq
MIRT2175722	hsa-miR-4510	CLIP-seq
MIRT2175723	hsa-miR-4515	CLIP-seq
MIRT2175726	hsa-miR-4740-5p	CLIP-seq
MIRT2175728	hsa-miR-492	CLIP-seq
MIRT2175729	hsa-miR-493	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT2175730	hsa-miR-619	CLIP-seq
MIRT2175731	hsa-miR-631	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq
MIRT797656	hsa-miR-15a	CLIP-seq
MIRT797657	hsa-miR-15b	CLIP-seq
MIRT797658	hsa-miR-16	CLIP-seq
MIRT797659	hsa-miR-195	CLIP-seq
MIRT797674	hsa-miR-214	CLIP-seq
MIRT797676	hsa-miR-3619-5p	CLIP-seq
MIRT797660	hsa-miR-424	CLIP-seq
MIRT797670	hsa-miR-497	CLIP-seq
MIRT797681	hsa-miR-761	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	10831612
GO:0005515	Function	Protein binding	IPI	10831612, 11847227, 16189514, 18234692, 18588884, 19368893, 21516116, 21988832, 25416956, 25502805, 27107012, 27173435, 29997244, 31515488, 32296183, 33961781, 35271311
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	IMP	10831612
GO:0005634	Component	Nucleus	IDA	18234692
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	30945270
GO:0005739	Component	Mitochondrion	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IDA	11809823
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005813	Component	Centrosome	IDA	16525022
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IDA	17646400
GO:0006110	Process	Regulation of glycolytic process	IMP	30945270
GO:0006457	Process	Protein folding	IBA
GO:0007098	Process	Centrosome cycle	IMP	16525022
GO:0010811	Process	Positive regulation of cell-substrate adhesion	ISS
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0019003	Function	GDP binding	IEA
GO:0031113	Process	Regulation of microtubule polymerization	IMP	16525022
GO:0031116	Process	Positive regulation of microtubule polymerization	IDA	10831612, 20740604
GO:0034260	Process	Negative regulation of GTPase activity	IDA	10831612
GO:0036064	Component	Ciliary basal body	IDA
GO:0051457	Process	Maintenance of protein location in nucleus	IDA	18234692
GO:0070830	Process	Bicellular tight junction assembly	ISS
GO:1903715	Process	Regulation of aerobic respiration	IMP	30945270

MIM	HGNC	e!Ensembl
601175	693	ENSG00000213465

P36404

Protein name

ADP-ribosylation factor-like protein 2

Protein function

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that d

PDB

3DOE , 3DOF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00025	Arf	3 → 176	ADP-ribosylation factor family	Domain

Sequence

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTAD

Sequence length

184

Interactions

View interactions

	Reactome
			Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Microcornea, rod-cone dystrophy, cataract, and posterior staphyloma 1	Pathogenic	rs184873330	RCV001263461	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17188265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18818514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18818514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36042172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35567502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29843637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31670868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18818514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29843637		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcornea, Rod-Cone Dystrophy, Cataract, And Posterior Staphyloma	Microcornea, Rod-Cone Dystrophy, Cataract, And Posterior Staphyloma	BEFREE	30945270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18818514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29265919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33617480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	23849777, 30945270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31858533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARL2 (ARF like GTPase 2)