LPA (lipoprotein(a))

Gene

• Entrez ID: 4018
• Gene name: Lipoprotein(a)
• Gene symbol: LPA
• Synonyms (NCBI Gene): AK38, APOA, LP
• Chromosome: 6
• Chromosome location: 6q25.3-q26
• Summary: The protein encoded by this gene is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The encoded protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1115416	hsa-miR-21	CLIP-seq
MIRT1115417	hsa-miR-4731-3p	CLIP-seq
MIRT1115418	hsa-miR-4789-5p	CLIP-seq
MIRT1115419	hsa-miR-4801	CLIP-seq
MIRT1115420	hsa-miR-590-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001968	Function	Fibronectin binding	IPI	2531657
GO:0004252	Function	Serine-type endopeptidase activity	IDA	2531657
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	TAS	8047165
GO:0005515	Function	Protein binding	IPI	2531657, 9269765
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	NAS	8047165
GO:0006869	Process	Lipid transport	IEA
GO:0008015	Process	Blood circulation	TAS	8047165
GO:0008201	Function	Heparin binding	NAS	2531657
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0034185	Function	Apolipoprotein binding	IEA
GO:0034185	Function	Apolipoprotein binding	IPI	9269765
GO:0034358	Component	Plasma lipoprotein particle	IDA	2531657

Other IDs

• MIM: 152200
• HGNC: 6667
• e!Ensembl: ENSG00000198670

Protein

• UniProt ID: P08519
• Protein name: Apolipoprotein(a) (Apo(a)) (Lp(a)) (EC 3.4.21.-)
• Protein function: Apo(a) is the main constituent of lipoprotein(a) (Lp(a)). It has serine proteinase activity and is able of autoproteolysis. Inhibits tissue-type plasminogen activator 1. Lp(a) may be a ligand for megalin/Gp 330.
• PDB: 1I71, 1JFN, 1KIV, 2FEB, 3KIV, 4BV5, 4BV7, 4BVC, 4BVD, 4BVV, 4BVW, 4KIV, 6RX7, 8TCE, 8V8Z, 8V9B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00051	Kringle	28 → 105	Kringle domain	Domain
  PF00051	Kringle	142 → 219	Kringle domain	Domain
  PF00051	Kringle	256 → 333	Kringle domain	Domain
  PF00051	Kringle	370 → 447	Kringle domain	Domain
  PF00051	Kringle	484 → 561	Kringle domain	Domain
  PF00051	Kringle	598 → 675	Kringle domain	Domain
  PF00051	Kringle	712 → 789	Kringle domain	Domain
  PF00051	Kringle	826 → 903	Kringle domain	Domain
  PF00051	Kringle	940 → 1017	Kringle domain	Domain
  PF00051	Kringle	1054 → 1131	Kringle domain	Domain
  PF00051	Kringle	1168 → 1245	Kringle domain	Domain
  PF00051	Kringle	1282 → 1359	Kringle domain	Domain
  PF00051	Kringle	1396 → 1473	Kringle domain	Domain
  PF00051	Kringle	1510 → 1587	Kringle domain	Domain
  PF00051	Kringle	1624 → 1701	Kringle domain	Domain
  PF00051	Kringle	1738 → 1815	Kringle domain	Domain
  PF00051	Kringle	1852 → 1929	Kringle domain	Domain
  PF00051	Kringle	1966 → 2043	Kringle domain	Domain
  PF00051	Kringle	2080 → 2157	Kringle domain	Domain
  PF00051	Kringle	2194 → 2271	Kringle domain	Domain
  PF00051	Kringle	2308 → 2385	Kringle domain	Domain
  PF00051	Kringle	2422 → 2499	Kringle domain	Domain
  PF00051	Kringle	2536 → 2613	Kringle domain	Domain
  PF00051	Kringle	2650 → 2727	Kringle domain	Domain
  PF00051	Kringle	2764 → 2841	Kringle domain	Domain
  PF00051	Kringle	2878 → 2955	Kringle domain	Domain
  PF00051	Kringle	2992 → 3069	Kringle domain	Domain
  PF00051	Kringle	3106 → 3183	Kringle domain	Domain
  PF00051	Kringle	3220 → 3297	Kringle domain	Domain
  PF00051	Kringle	3334 → 3411	Kringle domain	Domain
  PF00051	Kringle	3448 → 3525	Kringle domain	Domain
  PF00051	Kringle	3562 → 3639	Kringle domain	Domain
  PF00051	Kringle	3676 → 3753	Kringle domain	Domain
  PF00051	Kringle	3782 → 3859	Kringle domain	Domain
  PF00051	Kringle	3896 → 3973	Kringle domain	Domain
  PF00051	Kringle	4010 → 4087	Kringle domain	Domain
  PF00051	Kringle	4124 → 4201	Kringle domain	Domain
  PF00051	Kringle	4228 → 4307	Kringle domain	Domain
  PF00089	Trypsin	4328 → 4541	Trypsin	Domain

• Sequence:

  MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
  NRTTENYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
  VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
  YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
  PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
  IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
  TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
  NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
  VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
  APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
  GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
  RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
  RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
  WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
  TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNL
  TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT
  CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDA
  EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSS
  MTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVA
  PPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSH
  SRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
  VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
  YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
  PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
  IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
  TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
  NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
  VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
  APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
  GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
  RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
  RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
  WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
  TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNL
  TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT
  CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDA
  EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSS
  MTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVA
  PPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSH
  SRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
  VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
  YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
  PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
  IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
  TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
  NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
  VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
  APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
  GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
  RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
  RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
  WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
  TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNL
  TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT
  CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDA
  EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSS
  MTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTRDPSVRWEYCNLTQCSDAEGTAVA
  PPTITPIPSLEAPSEQAPTEQRPGVQECYHGNGQSYQGTYFITVTGRTCQAWSSMTPHSH
  SRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTDPSVRWEYCNLTRCSDAEWTAFVPPNVIL
  APSLEAFFEQALTEETPGVQDCYYHYGQSYRGTYSTTVTGRTCQAWSSMTPHQHSRTPEN
  YPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCLVTESSVLATLTVVPDPSTEA
  SSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGL
  TRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVSEQAPTEQSPTVQ
  DCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEIRP
  WCYTMDPSVRWEYCNLTQCPVMESTLLTTPTVVPVPSTELPSEEAPTENSTGVQDCYRGD
  GQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLTRNYCRNPDAEIRPWCYTMD
  PSVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCYHGDGRSYRG
  ISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTENYCRNPDSGKQPWCYTTDPCVRWE
  YCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHGNGQSYRGTFSTTV
  TGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCFTMDPSIRWEYCNLTR
  CSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKGYRGKKATTVTGTPCQEWAAQEPHRH
  STFIPGTNKWAGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDIPLCASSSFDCGKPQVE
  PKKCPGSIVGGCVAHPHSWPWQVSLRTRFGKHFCGGTLISPEWVLTAAHCLKKSSRPSSY
  KVILGAHQEVNLESHVQEIEVSRLFLEPTQADIALLKLSRPAVITDKVMPACLPSPDYMV
  TARTECYITGWGETQGTFGTGLLKEAQLLVIENEVCNHYKYICAEHLARGTDSCQGDSGG
  PLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMMRNN

• Sequence length: 4548

Pathways

KEGG:

Cholesterol metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Lipoprotein(a) deficiency, congenital	Pathogenic	rs121912503	RCV000015535	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Abnormal bleeding	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERMEDIATE CORONARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOPROTEIN(a) POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LPA-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myofibrillar myopathy 6	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THROMBOEMBOLISM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired porencephaly	Acquired Porencephaly	BEFREE	9577282		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	10484779		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	15530473, 29258004, 29327345, 30937890, 31722547		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	GWASCAT_DG	28753643		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	25463482		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10029588, 29334169		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29183667, 29417937		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	9844933		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27545006		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21116120		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10029588, 29334169		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28698208		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10354518, 12023414, 33008436	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10744589		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	14986480, 19225804, 26193960		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11786416		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18848929		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31811875		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	31133433		★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin Deficiency	BEFREE	30679327		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20400120		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20400120		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29182987, 37893562	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23490293, 26980774, 29182987		★☆☆☆☆ Found in Text Mining only
Aortic Stenosis Supravalvular	Aortic stenosis	Pubtator	37501168	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	23388002, 26685327, 27205885, 28814237, 30099661, 31188921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic valve calcification	Aortic valve calcification	GWASCAT_DG	23388002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic valve calcification	Aortic valve calcification	GWASDB_DG	23388002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Calcification of	Aortic valve disease	Pubtator	34903381	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	26685327, 28904058, 29528858, 29990619, 30928673, 30986377, 31150732		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	24161316, 24161338, 26656145, 28007139, 28554015, 28729361, 29128868, 31272552, 33878186, 34903381, 36036785, 37087364	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	24704946, 25340480, 25938632, 26656145, 26685327, 27205885, 27218270, 27665230, 27677946, 27761705, 28059953, 28068801, 28554015, 28651346, 28704465, 28729361, 29128868, 29194051, 29246959, 29609758, 29614432, 29852400, 29954600, 30087087, 30099661, 30482443, 30616181, 30702993, 31047003, 31111240, 31272552, 31407609, 31766423		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	34840125	Stimulate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	31637257		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10159508, 10168548, 10208849, 10235090, 10351984, 10984073, 11068075, 11122750, 11126727, 11145938, 11269751, 11485023, 11583708, 11786416, 11914260, 12111551, 12196525, 12208918, 1465128, 14680477, 15087247, 15905115, 15905467, 16750687, 18198982, 1829339, 19066833, 19287152, 1929512, 20106478, 20138621, 20965889, 21078622, 21283670, 21749171, 22187404, 22276189, 22516069, 22898070, 23546733, 2524837, 2556454, 25575512, 25604958, 26147378, 2667728, 26789774, 27007665, 27594539, 28051354, 28554015, 28557988, 28608522, 28793282, 28904058, 29096834, 29122817, 29182987, 29246963, 29556802, 29973585, 30003117, 30012717, 30064057, 30071823, 30579928, 30586750, 30596094, 30626499, 30685442, 30727753, 30928673, 31043469, 31079089, 31111240, 31119518, 31350625, 31472182, 31533471, 31642874, 31782556, 3472206, 7570736, 7679504, 7749816, 7750049, 7795650, 7874778, 7897323, 7988077, 8047165, 8108191, 8187213, 8370576, 8389224, 8494873, 8719606, 8782849, 8840853, 8937759, 9098440, 9184408, 9323585, 9520130, 9587674, 9684731, 9722025, 9799211		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	18806883		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10088766, 28476652	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30279412		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21042834		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10159508, 10168548, 10208849, 10235090, 10351984, 10984073, 11068075, 11122750, 11126727, 11145938, 11269751, 11485023, 11583708, 11786416, 11914260, 12196525, 12208918, 1465128, 14680477, 15087247, 15889191, 15905115, 15905467, 16750687, 18198982, 1829339, 19066833, 19287152, 1929512, 20106478, 20138621, 20965889, 21078622, 21283670, 21749171, 22187404, 22276189, 22516069, 22898070, 23546733, 24482375, 24977982, 2524837, 2556454, 25575512, 25604958, 26147378, 2667728, 26789774, 27007665, 27246356, 27594539, 28051354, 28153024, 28265881, 28554015, 28557988, 28608522, 28793282, 28801030, 28904058, 29096834, 29122817, 29129821, 29182987, 29246963, 29550494, 29556802, 29603377, 29609758, 29737015, 29912783, 29973585, 30003117, 30012717, 30064057, 30071823, 30150142, 30447089, 30579928, 30586750, 30596094, 30626499, 30685442, 30727753, 30732864, 30817043, 30846097, 30847681, 30928673, 31043469, 31060364, 31061262, 31079089, 31111240, 31119518, 31130489, 31147269, 31178022, 31261178, 31311555, 31340235, 31350625, 31472182, 31533471, 31577611, 31642874, 31655942, 31782556, 31783529, 3472206, 7570736, 7679504, 7750049, 7795650, 7863976, 7874778, 7897323, 7988077, 8047165, 8108191, 8187213, 8370576, 8389224, 8494873, 8546123, 8719606, 8782849, 8840853, 8937759, 9098440, 9184408, 9323585, 9520130, 9587674, 9684731, 9722025, 9799211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	12697748, 12950147, 14660654, 14680477, 16684693, 17299521, 18198982, 22969153, 2388631, 26880352, 27139787, 29973585, 30071823, 30846097, 32639518, 3472206, 34768851, 34840125, 35450575, 36036785, 36396201, 36706955, 37087364, 38631771, 7679504, 9535215, 9710118	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	1465128, 17845920, 9770530		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15905467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	16501423, 29246963, 30813164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	35450575	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	28502508		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10229916		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	39838177	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31145504		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30099661, 30872037		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	7749512		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	27139787	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30301839		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15535846, 17496233, 19477432, 19609003, 20234370, 22176685, 25209561, 27573077, 27644846, 28186980, 29805748		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	27545006		★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	20143106, 30635869		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9683776		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34147074, 38115320, 8366120, 8728315, 9651381	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15220934, 16018784, 19440550, 21093894, 27809800, 30503552, 31200184		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	30933971		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10072255, 10095177, 10098351, 10225140, 10616846, 10765043, 10856522, 11068075, 11514402, 11595020, 11822583, 11880218, 12127051, 12578287, 12589187, 12633762, 14578310, 14656611, 15003733, 15198961, 15554949, 15834589, 16141286, 16522905, 17975119, 18252779, 18682748, 18684164, 19124843, 19636317, 20138621, 21358543, 21392785, 21749171, 21757153, 21900290, 22327610, 22398274, 22516069, 22898069, 22930813, 23041907, 23243000, 23735860, 24129557, 24632281, 24977982, 25078778, 25318824, 25340480, 25736345, 25936332, 26377243, 26825471, 27417585, 27497506, 27665230, 27677946, 27761705, 27856457, 27856951, 27914033, 27998826, 28025448, 28120711, 28183512, 28203441, 28336560, 28364865, 28386638, 28434480, 28449027, 28505046, 28560179, 28632940, 28729361, 28750079, 28801029, 28899393, 28901563, 28912752, 28930591, 29071331, 29096835, 29096859, 29096860, 29096861, 29178936, 29246963, 29254484, 29264753, 29310992, 29325642, 29417937, 29511049, 29528858, 29566128, 29769559, 29852400, 29931232, 29948030, 29953581, 29960898, 29973585, 30012322, 30039523, 30071823, 30105804, 30150142, 30181995, 30219475, 30229482, 30287070, 30293769, 30317988, 30413653, 30527766, 30585793, 30608559, 30637725, 30675027, 30685442, 30772277, 30799420, 30830310, 30897995, 30946962, 30986377, 31023762, 31041550, 31103339, 31111240, 31113255, 31127398, 31169602, 31185726, 31220285, 31253441, 31261178, 31286992, 31315919, 31349819, 31350625, 31367887, 31371270, 31481563, 31493849, 31530423, 31577620, 31578080, 31625055, 31660394, 31683090, 31740238, 31753721, 31818446, 8546746, 8798245, 8878554, 9225824, 9580386, 9701454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	10098351, 17683612, 17975119, 18682748, 21167011, 23243000, 24632281, 25169167, 26776177, 26880352, 27998826, 28336560, 28632940, 28729361, 29973585, 30071823, 30759150, 31253441, 31493849, 31865966, 32220223, 32308405, 32466883, 32639518, 33878186, 34074296, 34213715, 34840125, 34954251, 36703868, 36739654, 37276941, 37381868, 37648373, 37948393	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17683612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	18775538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25708587	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	BEFREE	19124843, 21127300, 23533563		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	21127300, 22969153, 32964493	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30727753, 9520130		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	18599799		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29327345, 31824394		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	10572079, 28554015, 31272552, 34006274	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29130563		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31272552, 36066144	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10422994, 10484779, 10572079, 10604768, 10961170, 12443591, 12791946, 12972382, 17675027, 19135623, 19942259, 21078622, 21252144, 21804189, 22187404, 23092062, 23546733, 2530631, 28004340, 28608522, 29064597, 30635869, 30685442, 30786745, 31272552, 31437611, 31498021, 31597550, 7749512, 7897298, 8187226, 8194380, 8548412, 8665685, 9133253, 9164807		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	10484779		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	16197951, 17145597, 17478739, 17845920		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	24262325		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	11071628, 1440702, 17990970, 29064597, 7570736, 9701454, 9920527		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10029588, 29334169		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16612068		★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	2504859		★☆☆☆☆ Found in Text Mining only
Chondrodysplasia Punctata, Rhizomelic	Chondrodysplasia Punctata	BEFREE	9300783		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31340235		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30071823, 30920627, 31119518, 8272223, 8432847, 9237283, 9736817		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21640098, 24129557, 28838919, 29299849, 29378781, 30477725, 30585793, 8108191, 8272223, 9617557		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30481488		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9213183	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15517541, 17544220, 20480410, 21134377, 9683776		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21134377		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15220934, 18163888, 26937138, 30481488		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26937138	Associate	★☆☆☆☆ Found in Text Mining only
Congenital porencephaly	Congenital Porencephaly	BEFREE	9577282		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26656145, 28554015, 30354212, 31340235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10076490, 10095988, 10098351, 10168548, 10484779, 10720441, 11001801, 11126727, 11408005, 11485023, 11944029, 12145244, 15003733, 1534588, 1541665, 15553596, 15961173, 16258736, 17460176, 17569884, 17990970, 1824942, 1827234, 1829398, 19198611, 19623058, 20129380, 20435227, 20605575, 21127300, 21283670, 21804189, 23036009, 23735648, 23903772, 23978127, 23990263, 24530664, 24790998, 24925971, 2530631, 25310099, 25604958, 26340131, 26900838, 26934567, 27007665, 27417586, 27516387, 27530333, 27761705, 27856951, 28139221, 28238617, 28351002, 28408323, 28528455, 28566218, 28616285, 28700032, 28883849, 29064597, 29103916, 29246959, 29713054, 29747697, 2976021, 29769559, 29773088, 29852400, 29883631, 29960898, 29990619, 30030022, 30087087, 30316749, 30325422, 30447089, 30482443, 30522787, 30585793, 30685442, 30918220, 31017618, 31076417, 31079089, 31186284, 31286992, 31315919, 31448741, 31577620, 31818444, 7825589, 7882471, 8185133, 8187228, 8187239, 8546757, 8548413, 8640397, 8740296, 8782849, 8800499, 9125314, 9164807, 9170891, 9247362, 9258414, 9342009, 9377824, 9409256, 9468449, 9862182, 9915664		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20435227, 21378990		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10076490, 10095988, 10098351, 10168548, 10484779, 10583926, 10720441, 11001801, 11116062, 11126727, 11408005, 11485023, 11931574, 11944029, 12145244, 14578310, 14741073, 15003733, 1534588, 1541665, 15547022, 15553596, 15638812, 16258736, 17460176, 17569884, 17990970, 18001619, 18024933, 1824942, 1827234, 18280807, 1829398, 19014618, 19198611, 19623058, 19652890, 19880117, 1994714, 20032323, 20129380, 20435227, 20605575, 21078622, 21127300, 21252144, 21283670, 21519277, 21804189, 21966275, 22898070, 23036009, 23278389, 23735648, 23881580, 23903772, 23978127, 23990263, 24473507, 24530664, 24776095, 24790998, 24925971, 2530631, 25470794, 25604958, 26129832, 26302166, 26340131, 26900838, 26934567, 27007665, 27417586, 27516387, 27530333, 27761705, 27856951, 28132096, 28139221, 28168796, 28238617, 28351002, 28408323, 28528455, 28566218, 28616285, 28700032, 28705542, 28883849, 29064597, 29103916, 29246959, 29246963, 29309886, 29506713, 29615006, 29626436, 29703625, 29713054, 29730953, 2976021, 29769559, 29773088, 29852400, 29883631, 29926099, 29960898, 29990619, 30003307, 30030022, 30087087, 30170223, 30234895, 30316749, 30325422, 30447089, 30482443, 30585793, 30685442, 30894407, 30902787, 30918220, 31017618, 31076417, 31079089, 31141105, 31178022, 31186284, 31286992, 31315919, 31481563, 31577620, 7825589, 7882471, 8059696, 8185133, 8187228, 8187239, 8546757, 8548413, 8640397, 8665685, 8740296, 8782849, 8800499, 9125314, 9164807, 9170891, 9247362, 9258414, 9342009, 9356540, 9377824, 9402091, 9409256, 9468449, 9856341, 9862182, 9915664		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	10496479, 15210604, 20153741, 20435227, 21167011, 21889313, 21899732, 21966275, 22510820, 23978127, 24776095, 24790998, 26129832, 26776177, 26934567, 26946290, 28167353, 28408323, 29457025, 30003307, 30234895, 31481563, 31870308, 32066403, 32220223, 32284623, 32466883, 33878186, 34194581, 34325833, 35379196, 35534298, 36265803, 36703868, 38050271, 38255810, 39633571, 39953584, 7825589, 9377824, 9856341	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	11999088, 12940514, 17569884, 18280807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	1824942	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	19198611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20435227, 21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714974, 28714975, 29212778, 30003307, 30104761, 31186284		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	10098351, 14670093, 1541665, 18198982, 20032323, 2139920, 21900290, 23375930, 24372611, 24776095, 27091178, 28007139, 28408323, 28554015, 28566218, 28632940, 29449329, 29747697, 29926099, 32066403, 32964493, 33100089, 34840125, 35090557, 35246583, 36101804, 36691918, 38233012, 9935023	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	14660654, 24473507	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	10076490, 10095988, 10098351, 10168548, 10217375, 10407493, 10484779, 10720441, 10917717, 11001801, 11126727, 11408005, 11444649, 11485023, 11944029, 12145244, 12635466, 12860258, 14719130, 15003733, 1534588, 1541665, 15553596, 16258736, 17460176, 17569884, 17955342, 17990970, 1824942, 1827234, 1829398, 19198611, 1929512, 19623058, 1994714, 20032323, 20129380, 20435227, 20605575, 21078622, 21127300, 21252144, 21283670, 22192511, 22327610, 22998429, 23036009, 23278389, 23375930, 23653095, 23735648, 23903772, 23978127, 23990263, 24473507, 24530664, 24737438, 24790998, 24925971, 2530631, 25432390, 25604958, 26340131, 26892959, 26900838, 26934567, 27007665, 27074913, 27417586, 27516387, 27530333, 27761705, 27856951, 28007139, 28025448, 28078997, 28139221, 28192139, 28238617, 28351002, 28408323, 28528455, 28566218, 28583815, 28616285, 28700032, 28883849, 28916975, 29103916, 29246959, 29246963, 29262744, 29703846, 29713054, 2976021, 29769559, 29773088, 29852400, 29883631, 29926099, 29960898, 29990619, 30030022, 30087087, 30316749, 30325422, 30447089, 30482443, 30585793, 30591805, 30681575, 30685442, 30783476, 30918220, 30934954, 31017618, 31076417, 31079089, 31113255, 31186284, 31286992, 31315919, 31577620, 7825589, 7882471, 8185133, 8187228, 8187239, 8283932, 8370148, 8546757, 8548413, 8640397, 8740296, 8782849, 8800499, 9125314, 9164807, 9170891, 9247362, 9258414, 9342009, 9377824, 9409256, 9468449, 9862182, 9915664, 9935023		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	10484779		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17145597, 18198982		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	19198611, 21378990, 24262325, 28753643		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21378990, 21966275		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	27530333		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	36703868	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	35096275	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	35246583, 9377824	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31572464		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	20824408, 27388282		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	9164807		★☆☆☆☆ Found in Text Mining only
Deficiency of pyruvate kinase	Deficiency Of Pyruvate Kinase	BEFREE	17621533		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10422994, 15211075		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	10765043, 15211075, 16410024		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30584899		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12578864, 12739024, 14741073, 28510610, 28566218, 28633585, 28848612, 28971985, 29511049, 30527766, 30685442, 31396410, 31586210, 31804627, 7605385, 9714142, 9839108		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	30003307		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	36776228	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12578864, 12739024, 14563448, 14741073, 15554949, 17008631, 28510610, 28566218, 28633585, 28848612, 28971985, 29103916, 29511049, 30527766, 30685442, 31396410, 31586210, 31804627, 7605385, 8264136, 9701454, 9714142, 9839108		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16122830		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21900290, 31865966, 37452735, 8264136	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22748161	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	30003307		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12950147	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11847507, 12145244, 12950147, 29511049	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35528012	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10491765, 12716788, 16258736, 24793345, 29679801, 8504630, 8786731, 9625284		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10804324, 11189206, 12397529, 12950147, 21900290, 21986921, 24089516, 24622370, 25470794, 28132096, 28320383, 28386638, 28472352, 28633585, 28848612, 28866807, 28899393, 28934670, 28971985, 29264843, 30030022, 30105804, 31623352, 8495614, 8786017, 9714142		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	21986921		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15983325		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	11847507, 37159194	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12397529, 28472352		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	10395234, 12678656, 15768007, 16375582, 17473572, 21392785, 23247586, 29224833, 29303791, 31190079, 31327478, 31573456, 31818442, 7802728, 7897298, 8283932, 9568443		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	15768007, 31327478	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31113255, 9292635		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26327335, 29182028, 29328374		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31735549, 9225824		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30178473		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21093894, 31200184		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12123106, 9169895, 9468449		★☆☆☆☆ Found in Text Mining only
Familial hypercholesterolemia - homozygous	Hypercholesterolemia	BEFREE	10669652, 1829609, 29407885, 30064057		★☆☆☆☆ Found in Text Mining only
Familial hypobetalipoproteinemia	Hypobetalipoproteinemia	BEFREE	7489238		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	21116120, 28205098, 30093116		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30271079		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30411406		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	29447225		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	17005112		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	18592268		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29286147		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17928955		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	8297539		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28698208		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	1533952, 7802728, 8448860		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34209487, 35090557	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26656145, 28554015, 30354212, 31340235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	26656145, 28007139, 28554015, 37276941, 39809209	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart valve disease	Cardiac valvular disease	BEFREE	30616181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic amyloidosis	Hepatic amyloidosis	BEFREE	14986480		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32532356	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	17473580		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12071592		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12071592		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	10593369		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	10072255, 11486244, 12196525, 17473572, 21210756, 23357151, 23436135, 25248569, 25614280, 28919240, 29096824, 29096838, 29096843, 29096860, 29907443, 30608559, 30611543, 30744123, 30817043, 30846097, 31735549, 8177045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	12697372		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	10235090, 12889664, 1414897, 1493640, 1830890, 1836489, 19004443, 20129380, 24632281, 25248569, 25881720, 26340131, 26371983, 26632531, 27185354, 27594539, 28351002, 28429242, 28801029, 29029165, 29096862, 29303791, 29480541, 29603377, 30150142, 30170223, 30270088, 30317988, 30664016, 30772277, 30846097, 31103339, 31262370, 31393421, 31436336, 31683090, 7607414, 8197753, 8370148, 8500516, 8548413, 8722744, 9222877		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11281343, 15638812, 15768007, 22422337, 23859863, 27457726		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	10159508, 20129380, 29096836, 7586640, 9349601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	11092828, 11595020, 12889664, 17950741, 7802728		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	25708587, 30759150	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	Pubtator	1430218	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	2139920, 24632281, 2524837, 25708587, 30846097, 31436336, 32466883, 36396201, 36473758, 37183858, 38297066, 8163653	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	32466883	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	10235090, 1414897, 1493640, 1830890, 1836489, 19004443, 20129380, 24632281, 25248569, 26340131, 26371983, 26632531, 27594539, 28351002, 28429242, 28502508, 28801029, 29096862, 29303791, 29480541, 29603377, 30150142, 30170223, 30270088, 30664016, 30772277, 30846097, 31103339, 31393421, 31436336, 31683090, 7607414, 8197753, 8370148, 8548413, 8722744, 9222877		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	Pubtator	1430218	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	31642874, 8182397		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IV	Hyperlipoproteinemia	BEFREE	11595020, 15820086		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	BEFREE	11944029, 27859540, 29096834, 29096840, 29096860, 30016414, 30817043, 8177045, 8412746, 87831		★☆☆☆☆ Found in Text Mining only
Hypermagnesemia	Hypermagnesemia	BEFREE	27875816		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36739654	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	11833851		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15554949, 15834589, 17008631, 17473572, 25489783, 28883849, 30527766, 30963276, 31009111, 31272552, 31586210, 31735549, 8297539, 9169895, 9306351, 9349601, 9642116		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	7633941		★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemia, Familial	Hypoalphalipoproteinemia	BEFREE	7802728, 8283932		★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	9012641		★☆☆☆☆ Found in Text Mining only
Hypobetalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	7489238		★☆☆☆☆ Found in Text Mining only
Hypoplasminogenemia	Hypoplasminogenemia	BEFREE	31806727, 8585045		★☆☆☆☆ Found in Text Mining only
Hypoprebetalipoproteinemia	Hypoprebetalipoproteinemia	CTD_human_DG	10484779		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	1386404, 27457726		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10669658		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20463180		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	9306351		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	9213183	Associate	★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	24760552	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	10496256, 11440434, 22898070, 9149281		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	10572079, 10650850, 11923626, 12443591, 1440702, 22898070, 27856951, 28004340, 28139007, 29245288, 29246963, 29264843, 30786745, 31076261, 31272552, 31597550, 8548412, 8958390, 9920527		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11133740		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	10201000, 8731088	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10616846, 24129557, 7605385, 8546123, 8731088, 9712693		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	10352198, 10469373, 10616846, 16382017, 26340131		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30071823, 8432847	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	16806561, 30071823, 30920627, 31119518, 8108191, 8272223, 8432847, 9237283, 9617557, 9736817		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	28883849, 30918220		★☆☆☆☆ Found in Text Mining only
Legg-Calve-Perthes Disease	Legg-Calve-Perthes Disease	BEFREE	12208918		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	29480541, 7802728, 8283932, 9568443		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16628632, 21102517, 21649721, 23569130, 27583415, 27822883, 30271176, 31211449, 8728315		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	8728315		★☆☆☆☆ Found in Text Mining only
Lp(A) Deficiency, Congenital	Congenital Lipoprotein deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30759150, 38124403	Associate	★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	15869586, 16061602, 21561729, 29248890, 30577621		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35775881	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15754029, 26573664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15535846, 17496233, 19477432, 19609003, 20234370, 22176685, 25209561, 27573077, 27644846, 28186980, 29805748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29328374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18592268		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15220934, 16018784, 19440550, 27809800, 30503552		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31668663		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19025891, 21978933, 31145504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15530853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22797060		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15143072, 17442497, 17575049, 20529378, 23611148, 23752273, 24828490, 27644846, 28792932, 29254484, 30694446, 9683776		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15517541, 17544220, 20480410, 21134377, 9683776		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	10700477		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29309788		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	1430218	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29236751		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21410987, 26911630, 30371334, 31331432, 31625055		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30486734		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32284623	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30618716		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	24335248		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	36703868	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis, MPS-IV-A	Mucopolysaccharidosis	BEFREE	28560179		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25468275, 28605269		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	28994502		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10407493, 11199329, 12127051, 12578871, 14580163, 14680477, 1829398, 18682504, 18682748, 19014618, 19509380, 21231777, 21283670, 21519277, 22516069, 23375930, 25938632, 26656145, 27185354, 27218270, 27665230, 27677946, 28059953, 28408323, 28651346, 28838919, 29258680, 2969235, 29883631, 30411527, 30522787, 30667276, 31076261, 31111240, 31272552, 8194380, 8284108, 8495614, 9259986, 9733226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	10496479, 14680477, 21493818, 24475106, 26776177, 28408323, 28838919, 32308405, 35090557, 36396201, 38255810, 38631771, 8837562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	26656145, 31272552	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16053196, 18682504, 20106478, 26859812, 28608522, 29096862, 30522787, 31448741		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	34096654, 35090557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	28994502		★☆☆☆☆ Found in Text Mining only
Myopathy Central Core	Central core myopathy	Pubtator	23293173	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10208849, 12746434, 15220934, 15517541, 19001604, 20480410, 25158955, 27388282, 27573077, 28186980, 30048709, 30053596, 30301839, 9683776		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	10669658, 14717931, 15827892, 28994502, 31190079, 7611249, 8731088, 8971882, 9697670		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	14717931, 34511173, 8731088	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	10669658		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27341347	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27341347		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	30503552	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10604768, 15130779, 27638928, 29236751, 29885564, 30271079, 31325043, 31669498, 8883493		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15340115	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21116120, 22659570, 29859140		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23720361	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15220934, 16018784, 19440550, 27809800, 30503552		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30503552	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31668663		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29875659		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34191436	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	12322821		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31760306		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	15768007, 24760552, 33878186, 34601942	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	15768007, 17942087, 22898070, 24760552, 28923990, 29096834		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	31285632		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29096834		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	17942087, 21252144, 22898070, 24760552, 30016414, 8141853		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	LHGDN	17942087		★☆☆☆☆ Found in Text Mining only
Plasminogen Deficiency, Type I	Plasminogen Deficiency	BEFREE	9727530		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	26079546	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	26079546	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27619403, 28051891, 28937295, 29359480		★☆☆☆☆ Found in Text Mining only
Porencephaly	Porencephaly	BEFREE	9577282		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	27822883		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31714004		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10422994, 15211075		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	8937759		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	BEFREE	20400120		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19025891, 21978933, 31145504		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	10650850, 12443591, 9386668		★☆☆☆☆ Found in Text Mining only
Protein S Deficiency	Protein S Deficiency	BEFREE	11864707, 23092062		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	10469373, 35775881	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22835076, 30830310		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24828490		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	16382017, 26340131, 9294105		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	11853190, 12397529		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	27545749		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	18978343		★☆☆☆☆ Found in Text Mining only
Rheumatic aortic stenosis	Rheumatic Aortic Stenosis	GWASCAT_DG	29511194		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088766, 18006645, 21398331, 22354754, 28476652, 29961573, 7605385		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28793282		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	35246583	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28317295		★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	9686815		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31089476		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	30789151		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	GWASDB_DG	23103227		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37013557	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29134466		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29848921, 31577620		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15530853		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31272552, 40596960	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	27457726		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29098350		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	34096654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	BEFREE	10650856, 12172465, 15833890, 16154434, 17403113, 17473572, 22422337, 23247586, 28901563, 30486734, 31133433		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	35023653	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	1554698		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	12697748, 16684693, 25708587	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	12690566		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22797060, 30565661		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22797060		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	31609068		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30567518		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	10084580		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	39809209	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34954251	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10961170, 21252144, 22898070, 28901563, 30679327, 31472182, 7749512		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32639518	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	26900838	Associate	★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	BEFREE	11230837		★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	37501168	Associate	★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Zellweger Syndrome	BEFREE	9300783		★☆☆☆☆ Found in Text Mining only