LOXL2 (lysyl oxidase like 2)

Gene

• Entrez ID: 4017
• Gene name: Lysyl oxidase like 2
• Gene symbol: LOXL2
• Synonyms (NCBI Gene): LOR, LOR2, WS9-14
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004135	hsa-miR-192-5p	Microarray	16822819
MIRT438918	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438918	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT709489	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT709488	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT709487	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT709486	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT709485	hsa-miR-6793-5p	HITS-CLIP	19536157
MIRT709484	hsa-miR-376a-5p	HITS-CLIP	19536157
MIRT709483	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT709482	hsa-miR-4507	HITS-CLIP	19536157
MIRT709481	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT709480	hsa-miR-4760-5p	HITS-CLIP	19536157
MIRT709479	hsa-miR-8061	HITS-CLIP	19536157
MIRT709489	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT709488	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT709487	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT709486	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT709485	hsa-miR-6793-5p	HITS-CLIP	19536157
MIRT709484	hsa-miR-376a-5p	HITS-CLIP	19536157
MIRT709483	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT709482	hsa-miR-4507	HITS-CLIP	19536157
MIRT709481	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT709480	hsa-miR-4760-5p	HITS-CLIP	19536157
MIRT709479	hsa-miR-8061	HITS-CLIP	19536157
MIRT487568	hsa-miR-595	PAR-CLIP	23592263
MIRT487567	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT487566	hsa-miR-5697	PAR-CLIP	23592263
MIRT487564	hsa-miR-3691-3p	PAR-CLIP	23592263
MIRT487565	hsa-miR-4677-3p	PAR-CLIP	23592263
MIRT487563	hsa-miR-4679	PAR-CLIP	23592263
MIRT487562	hsa-miR-1297	PAR-CLIP	23592263
MIRT487561	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT487560	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT487558	hsa-miR-4465	PAR-CLIP	23592263
MIRT487559	hsa-miR-498	PAR-CLIP	23592263
MIRT487557	hsa-miR-410-5p	PAR-CLIP	23592263
MIRT440322	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440322	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT487561	hsa-miR-26a-5p	Luciferase reporter assay	26983694
MIRT736793	hsa-miR-29a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR	31662451
MIRT709489	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT709488	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT709487	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT709486	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT709485	hsa-miR-6793-5p	HITS-CLIP	19536157
MIRT709484	hsa-miR-376a-5p	HITS-CLIP	19536157
MIRT709483	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT709482	hsa-miR-4507	HITS-CLIP	19536157
MIRT709481	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT709480	hsa-miR-4760-5p	HITS-CLIP	19536157
MIRT709479	hsa-miR-8061	HITS-CLIP	19536157
MIRT709489	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT709488	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT709487	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT709486	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT709485	hsa-miR-6793-5p	HITS-CLIP	19536157
MIRT709484	hsa-miR-376a-5p	HITS-CLIP	19536157
MIRT709483	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT709482	hsa-miR-4507	HITS-CLIP	19536157
MIRT709481	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT709480	hsa-miR-4760-5p	HITS-CLIP	19536157
MIRT709479	hsa-miR-8061	HITS-CLIP	19536157
MIRT487568	hsa-miR-595	PAR-CLIP	23592263
MIRT487567	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT487566	hsa-miR-5697	PAR-CLIP	23592263
MIRT487564	hsa-miR-3691-3p	PAR-CLIP	23592263
MIRT487565	hsa-miR-4677-3p	PAR-CLIP	23592263
MIRT487563	hsa-miR-4679	PAR-CLIP	23592263
MIRT487562	hsa-miR-1297	PAR-CLIP	23592263
MIRT487561	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT487560	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT487558	hsa-miR-4465	PAR-CLIP	23592263
MIRT487559	hsa-miR-498	PAR-CLIP	23592263
MIRT487557	hsa-miR-410-5p	PAR-CLIP	23592263
MIRT1115364	hsa-miR-1224-5p	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT1115366	hsa-miR-26a	CLIP-seq
MIRT1115367	hsa-miR-26b	CLIP-seq
MIRT1115368	hsa-miR-3200-5p	CLIP-seq
MIRT1115369	hsa-miR-3691-5p	CLIP-seq
MIRT1115370	hsa-miR-3936	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT1115372	hsa-miR-4447	CLIP-seq
MIRT1115373	hsa-miR-4472	CLIP-seq
MIRT1115374	hsa-miR-4488	CLIP-seq
MIRT1115375	hsa-miR-4649-3p	CLIP-seq
MIRT1115376	hsa-miR-4651	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT1115379	hsa-miR-4675	CLIP-seq
MIRT1115380	hsa-miR-4697-5p	CLIP-seq
MIRT1115381	hsa-miR-4741	CLIP-seq
MIRT1115382	hsa-miR-4751	CLIP-seq
MIRT1115383	hsa-miR-4752	CLIP-seq
MIRT1115384	hsa-miR-608	CLIP-seq
MIRT1115385	hsa-miR-711	CLIP-seq
MIRT1550835	hsa-miR-1256	CLIP-seq
MIRT1550836	hsa-miR-1262	CLIP-seq
MIRT1550837	hsa-miR-1275	CLIP-seq
MIRT1550838	hsa-miR-151-3p	CLIP-seq
MIRT1115366	hsa-miR-26a	CLIP-seq
MIRT1115367	hsa-miR-26b	CLIP-seq
MIRT1550839	hsa-miR-29a	CLIP-seq
MIRT1550840	hsa-miR-29b	CLIP-seq
MIRT1550841	hsa-miR-29c	CLIP-seq
MIRT1550842	hsa-miR-3147	CLIP-seq
MIRT1550843	hsa-miR-3613-3p	CLIP-seq
MIRT1550844	hsa-miR-3616-3p	CLIP-seq
MIRT1550845	hsa-miR-369-3p	CLIP-seq
MIRT1550846	hsa-miR-374a	CLIP-seq
MIRT1550847	hsa-miR-374b	CLIP-seq
MIRT1550848	hsa-miR-4271	CLIP-seq
MIRT1550849	hsa-miR-4425	CLIP-seq
MIRT1550850	hsa-miR-4463	CLIP-seq
MIRT1550851	hsa-miR-4492	CLIP-seq
MIRT1550852	hsa-miR-4494	CLIP-seq
MIRT1550853	hsa-miR-4498	CLIP-seq
MIRT1550854	hsa-miR-4499	CLIP-seq
MIRT1550855	hsa-miR-4505	CLIP-seq
MIRT1550856	hsa-miR-4665-5p	CLIP-seq
MIRT1550857	hsa-miR-4701-3p	CLIP-seq
MIRT1550858	hsa-miR-4710	CLIP-seq
MIRT1550859	hsa-miR-4721	CLIP-seq
MIRT1550860	hsa-miR-4725-3p	CLIP-seq
MIRT1550861	hsa-miR-4725-5p	CLIP-seq
MIRT1550862	hsa-miR-4777-5p	CLIP-seq
MIRT1550863	hsa-miR-499a-5p	CLIP-seq
MIRT1550864	hsa-miR-504	CLIP-seq
MIRT1550865	hsa-miR-548ac	CLIP-seq
MIRT1550866	hsa-miR-548d-3p	CLIP-seq
MIRT1550867	hsa-miR-548z	CLIP-seq
MIRT1550868	hsa-miR-601	CLIP-seq
MIRT1550869	hsa-miR-625	CLIP-seq
MIRT1550870	hsa-miR-7	CLIP-seq
MIRT1550871	hsa-miR-762	CLIP-seq
MIRT1550836	hsa-miR-1262	CLIP-seq
MIRT1550844	hsa-miR-3616-3p	CLIP-seq
MIRT1550851	hsa-miR-4492	CLIP-seq
MIRT1550853	hsa-miR-4498	CLIP-seq
MIRT1550855	hsa-miR-4505	CLIP-seq
MIRT1550857	hsa-miR-4701-3p	CLIP-seq
MIRT1550858	hsa-miR-4710	CLIP-seq
MIRT1550859	hsa-miR-4721	CLIP-seq
MIRT1550871	hsa-miR-762	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT2262956	hsa-miR-140-3p	CLIP-seq
MIRT1115366	hsa-miR-26a	CLIP-seq
MIRT1115367	hsa-miR-26b	CLIP-seq
MIRT2262957	hsa-miR-3138	CLIP-seq
MIRT2262958	hsa-miR-338-3p	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT2262959	hsa-miR-4530	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT2262960	hsa-miR-4660	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT2262961	hsa-miR-4800-5p	CLIP-seq
MIRT2262962	hsa-miR-646	CLIP-seq
MIRT2262963	hsa-miR-766	CLIP-seq
MIRT2262957	hsa-miR-3138	CLIP-seq
MIRT2262958	hsa-miR-338-3p	CLIP-seq
MIRT2262959	hsa-miR-4530	CLIP-seq
MIRT2262960	hsa-miR-4660	CLIP-seq
MIRT2262961	hsa-miR-4800-5p	CLIP-seq
MIRT2262962	hsa-miR-646	CLIP-seq
MIRT2262963	hsa-miR-766	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT1550838	hsa-miR-151-3p	CLIP-seq
MIRT2430798	hsa-miR-192	CLIP-seq
MIRT2430799	hsa-miR-2113	CLIP-seq
MIRT2430800	hsa-miR-215	CLIP-seq
MIRT2430801	hsa-miR-218	CLIP-seq
MIRT1115366	hsa-miR-26a	CLIP-seq
MIRT1115367	hsa-miR-26b	CLIP-seq
MIRT2430802	hsa-miR-2964a-5p	CLIP-seq
MIRT2430803	hsa-miR-323b-3p	CLIP-seq
MIRT2430804	hsa-miR-3647-3p	CLIP-seq
MIRT2430805	hsa-miR-3662	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT2430806	hsa-miR-3977	CLIP-seq
MIRT2430807	hsa-miR-4272	CLIP-seq
MIRT1550850	hsa-miR-4463	CLIP-seq
MIRT1550854	hsa-miR-4499	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT1550862	hsa-miR-4777-5p	CLIP-seq
MIRT2430808	hsa-miR-513a-3p	CLIP-seq
MIRT1550868	hsa-miR-601	CLIP-seq
MIRT2430809	hsa-miR-628-5p	CLIP-seq
MIRT2430810	hsa-miR-636	CLIP-seq
MIRT1550870	hsa-miR-7	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT2438372	hsa-miR-146b-3p	CLIP-seq
MIRT1550839	hsa-miR-29a	CLIP-seq
MIRT1550840	hsa-miR-29b	CLIP-seq
MIRT1550841	hsa-miR-29c	CLIP-seq
MIRT2438373	hsa-miR-339-3p	CLIP-seq
MIRT2438374	hsa-miR-339-5p	CLIP-seq
MIRT1550843	hsa-miR-3613-3p	CLIP-seq
MIRT2438375	hsa-miR-3907	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT2438376	hsa-miR-4276	CLIP-seq
MIRT2438377	hsa-miR-4643	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT2438378	hsa-miR-4717-3p	CLIP-seq
MIRT1550861	hsa-miR-4725-5p	CLIP-seq
MIRT1550864	hsa-miR-504	CLIP-seq
MIRT1550865	hsa-miR-548ac	CLIP-seq
MIRT1550866	hsa-miR-548d-3p	CLIP-seq
MIRT1550867	hsa-miR-548z	CLIP-seq
MIRT2438379	hsa-miR-642b	CLIP-seq
MIRT2562292	hsa-miR-1225-3p	CLIP-seq
MIRT2562293	hsa-miR-1233	CLIP-seq
MIRT2562294	hsa-miR-1245b-5p	CLIP-seq
MIRT2562295	hsa-miR-1253	CLIP-seq
MIRT2562296	hsa-miR-1266	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT2562297	hsa-miR-134	CLIP-seq
MIRT2438372	hsa-miR-146b-3p	CLIP-seq
MIRT1550838	hsa-miR-151-3p	CLIP-seq
MIRT2562298	hsa-miR-1972	CLIP-seq
MIRT2430799	hsa-miR-2113	CLIP-seq
MIRT2430801	hsa-miR-218	CLIP-seq
MIRT2562299	hsa-miR-2355-3p	CLIP-seq
MIRT1115366	hsa-miR-26a	CLIP-seq
MIRT1115367	hsa-miR-26b	CLIP-seq
MIRT2430802	hsa-miR-2964a-5p	CLIP-seq
MIRT1550839	hsa-miR-29a	CLIP-seq
MIRT1550840	hsa-miR-29b	CLIP-seq
MIRT1550841	hsa-miR-29c	CLIP-seq
MIRT2562300	hsa-miR-3118	CLIP-seq
MIRT2262957	hsa-miR-3138	CLIP-seq
MIRT2562301	hsa-miR-3142	CLIP-seq
MIRT2562302	hsa-miR-3164	CLIP-seq
MIRT2562303	hsa-miR-3183	CLIP-seq
MIRT2430803	hsa-miR-323b-3p	CLIP-seq
MIRT2562304	hsa-miR-326	CLIP-seq
MIRT2562305	hsa-miR-330-5p	CLIP-seq
MIRT2262958	hsa-miR-338-3p	CLIP-seq
MIRT2438373	hsa-miR-339-3p	CLIP-seq
MIRT2438374	hsa-miR-339-5p	CLIP-seq
MIRT1550843	hsa-miR-3613-3p	CLIP-seq
MIRT2430804	hsa-miR-3647-3p	CLIP-seq
MIRT2562306	hsa-miR-3664-3p	CLIP-seq
MIRT1550845	hsa-miR-369-3p	CLIP-seq
MIRT1550846	hsa-miR-374a	CLIP-seq
MIRT1550847	hsa-miR-374b	CLIP-seq
MIRT2438375	hsa-miR-3907	CLIP-seq
MIRT2562307	hsa-miR-3922-5p	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT2430806	hsa-miR-3977	CLIP-seq
MIRT2430807	hsa-miR-4272	CLIP-seq
MIRT2438376	hsa-miR-4276	CLIP-seq
MIRT2562308	hsa-miR-4434	CLIP-seq
MIRT1550850	hsa-miR-4463	CLIP-seq
MIRT2562309	hsa-miR-4479	CLIP-seq
MIRT1550854	hsa-miR-4499	CLIP-seq
MIRT2562310	hsa-miR-4501	CLIP-seq
MIRT2562311	hsa-miR-4502	CLIP-seq
MIRT2562312	hsa-miR-4516	CLIP-seq
MIRT2562313	hsa-miR-4518	CLIP-seq
MIRT2262959	hsa-miR-4530	CLIP-seq
MIRT2562314	hsa-miR-4531	CLIP-seq
MIRT2438377	hsa-miR-4643	CLIP-seq
MIRT2562315	hsa-miR-4646-3p	CLIP-seq
MIRT2562316	hsa-miR-4650-5p	CLIP-seq
MIRT2562317	hsa-miR-4656	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT2262960	hsa-miR-4660	CLIP-seq
MIRT2562318	hsa-miR-4667-5p	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT2562319	hsa-miR-4700-5p	CLIP-seq
MIRT2562320	hsa-miR-4708-3p	CLIP-seq
MIRT2438378	hsa-miR-4717-3p	CLIP-seq
MIRT2562321	hsa-miR-4723-3p	CLIP-seq
MIRT1550861	hsa-miR-4725-5p	CLIP-seq
MIRT1550862	hsa-miR-4777-5p	CLIP-seq
MIRT2262961	hsa-miR-4800-5p	CLIP-seq
MIRT1550864	hsa-miR-504	CLIP-seq
MIRT2430808	hsa-miR-513a-3p	CLIP-seq
MIRT1550865	hsa-miR-548ac	CLIP-seq
MIRT1550866	hsa-miR-548d-3p	CLIP-seq
MIRT1550867	hsa-miR-548z	CLIP-seq
MIRT2562322	hsa-miR-597	CLIP-seq
MIRT1550868	hsa-miR-601	CLIP-seq
MIRT2430810	hsa-miR-636	CLIP-seq
MIRT2562323	hsa-miR-637	CLIP-seq
MIRT2438379	hsa-miR-642b	CLIP-seq
MIRT2262962	hsa-miR-646	CLIP-seq
MIRT2562324	hsa-miR-668	CLIP-seq
MIRT1550870	hsa-miR-7	CLIP-seq
MIRT2562325	hsa-miR-760	CLIP-seq
MIRT2262963	hsa-miR-766	CLIP-seq
MIRT2562326	hsa-miR-767-5p	CLIP-seq
MIRT2562292	hsa-miR-1225-3p	CLIP-seq
MIRT2562293	hsa-miR-1233	CLIP-seq
MIRT2562294	hsa-miR-1245b-5p	CLIP-seq
MIRT2562295	hsa-miR-1253	CLIP-seq
MIRT2562296	hsa-miR-1266	CLIP-seq
MIRT1115365	hsa-miR-128	CLIP-seq
MIRT2562297	hsa-miR-134	CLIP-seq
MIRT2438372	hsa-miR-146b-3p	CLIP-seq
MIRT1550838	hsa-miR-151-3p	CLIP-seq
MIRT2684053	hsa-miR-15a	CLIP-seq
MIRT2684054	hsa-miR-15b	CLIP-seq
MIRT2684055	hsa-miR-16	CLIP-seq
MIRT2684056	hsa-miR-195	CLIP-seq
MIRT2562298	hsa-miR-1972	CLIP-seq
MIRT2430799	hsa-miR-2113	CLIP-seq
MIRT2430801	hsa-miR-218	CLIP-seq
MIRT2562299	hsa-miR-2355-3p	CLIP-seq
MIRT2430802	hsa-miR-2964a-5p	CLIP-seq
MIRT1550839	hsa-miR-29a	CLIP-seq
MIRT1550840	hsa-miR-29b	CLIP-seq
MIRT1550841	hsa-miR-29c	CLIP-seq
MIRT2562300	hsa-miR-3118	CLIP-seq
MIRT2262957	hsa-miR-3138	CLIP-seq
MIRT2562301	hsa-miR-3142	CLIP-seq
MIRT2562302	hsa-miR-3164	CLIP-seq
MIRT2562303	hsa-miR-3183	CLIP-seq
MIRT2430803	hsa-miR-323b-3p	CLIP-seq
MIRT2562304	hsa-miR-326	CLIP-seq
MIRT2562305	hsa-miR-330-5p	CLIP-seq
MIRT2262958	hsa-miR-338-3p	CLIP-seq
MIRT2438373	hsa-miR-339-3p	CLIP-seq
MIRT2438374	hsa-miR-339-5p	CLIP-seq
MIRT1550843	hsa-miR-3613-3p	CLIP-seq
MIRT2430804	hsa-miR-3647-3p	CLIP-seq
MIRT2562306	hsa-miR-3664-3p	CLIP-seq
MIRT2684057	hsa-miR-3670	CLIP-seq
MIRT1550845	hsa-miR-369-3p	CLIP-seq
MIRT1550846	hsa-miR-374a	CLIP-seq
MIRT1550847	hsa-miR-374b	CLIP-seq
MIRT2438375	hsa-miR-3907	CLIP-seq
MIRT2562307	hsa-miR-3922-5p	CLIP-seq
MIRT1115371	hsa-miR-3941	CLIP-seq
MIRT2684058	hsa-miR-3943	CLIP-seq
MIRT2430806	hsa-miR-3977	CLIP-seq
MIRT2684059	hsa-miR-423-3p	CLIP-seq
MIRT2684060	hsa-miR-424	CLIP-seq
MIRT2438376	hsa-miR-4276	CLIP-seq
MIRT2562308	hsa-miR-4434	CLIP-seq
MIRT1550850	hsa-miR-4463	CLIP-seq
MIRT2562309	hsa-miR-4479	CLIP-seq
MIRT1550854	hsa-miR-4499	CLIP-seq
MIRT2562310	hsa-miR-4501	CLIP-seq
MIRT2562311	hsa-miR-4502	CLIP-seq
MIRT2562312	hsa-miR-4516	CLIP-seq
MIRT2562313	hsa-miR-4518	CLIP-seq
MIRT2684061	hsa-miR-4524	CLIP-seq
MIRT2262959	hsa-miR-4530	CLIP-seq
MIRT2562314	hsa-miR-4531	CLIP-seq
MIRT2684062	hsa-miR-4635	CLIP-seq
MIRT2438377	hsa-miR-4643	CLIP-seq
MIRT2562315	hsa-miR-4646-3p	CLIP-seq
MIRT2562316	hsa-miR-4650-5p	CLIP-seq
MIRT2562317	hsa-miR-4656	CLIP-seq
MIRT1115377	hsa-miR-466	CLIP-seq
MIRT2262960	hsa-miR-4660	CLIP-seq
MIRT2562318	hsa-miR-4667-5p	CLIP-seq
MIRT1115378	hsa-miR-4672	CLIP-seq
MIRT2562319	hsa-miR-4700-5p	CLIP-seq
MIRT2562320	hsa-miR-4708-3p	CLIP-seq
MIRT1550858	hsa-miR-4710	CLIP-seq
MIRT2684063	hsa-miR-4711-3p	CLIP-seq
MIRT2438378	hsa-miR-4717-3p	CLIP-seq
MIRT2562321	hsa-miR-4723-3p	CLIP-seq
MIRT1550861	hsa-miR-4725-5p	CLIP-seq
MIRT1550862	hsa-miR-4777-5p	CLIP-seq
MIRT2684064	hsa-miR-4792	CLIP-seq
MIRT2262961	hsa-miR-4800-5p	CLIP-seq
MIRT2684065	hsa-miR-497	CLIP-seq
MIRT2684066	hsa-miR-503	CLIP-seq
MIRT1550864	hsa-miR-504	CLIP-seq
MIRT2430808	hsa-miR-513a-3p	CLIP-seq
MIRT1550865	hsa-miR-548ac	CLIP-seq
MIRT1550866	hsa-miR-548d-3p	CLIP-seq
MIRT1550867	hsa-miR-548z	CLIP-seq
MIRT2562322	hsa-miR-597	CLIP-seq
MIRT1550868	hsa-miR-601	CLIP-seq
MIRT2684067	hsa-miR-633	CLIP-seq
MIRT2430810	hsa-miR-636	CLIP-seq
MIRT2562323	hsa-miR-637	CLIP-seq
MIRT2438379	hsa-miR-642b	CLIP-seq
MIRT2262962	hsa-miR-646	CLIP-seq
MIRT2562324	hsa-miR-668	CLIP-seq
MIRT1550870	hsa-miR-7	CLIP-seq
MIRT2562325	hsa-miR-760	CLIP-seq
MIRT2262963	hsa-miR-766	CLIP-seq
MIRT2562326	hsa-miR-767-5p	CLIP-seq
MIRT2684068	hsa-miR-892a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F5	Unknown	20012301

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	25959397
GO:0000785	Component	Chromatin	IDA	27735137
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0001935	Process	Endothelial cell proliferation	IMP	21835952
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002040	Process	Sprouting angiogenesis	IMP	21835952
GO:0004720	Function	Protein-lysine 6-oxidase activity	IBA
GO:0004720	Function	Protein-lysine 6-oxidase activity	IDA	23319596, 25959397, 27735137, 29581294
GO:0004720	Function	Protein-lysine 6-oxidase activity	IEA
GO:0005507	Function	Copper ion binding	IDA	29581294
GO:0005507	Function	Copper ion binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	29581294
GO:0005515	Function	Protein binding	IPI	16096638, 24863880, 27339457, 30676771, 31759052, 31911079
GO:0005576	Component	Extracellular region	IEA
GO:0005604	Component	Basement membrane	IEA
GO:0005604	Component	Basement membrane	ISS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23319596
GO:0005634	Component	Nucleus	IDA	22204712, 24414204
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	16096638
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	28332555
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	24239292
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016641	Function	Oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor	IEA
GO:0018057	Process	Peptidyl-lysine oxidation	IDA	25959397, 27735137, 29581294
GO:0030199	Process	Collagen fibril organization	IBA
GO:0030199	Process	Collagen fibril organization	IMP	21835952
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	ISS
GO:0036211	Process	Protein modification process	IDA	23319596
GO:0043542	Process	Endothelial cell migration	IMP	21835952
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16096638
GO:0046688	Process	Response to copper ion	IDA	23319596
GO:0046872	Function	Metal ion binding	IEA
GO:0070492	Function	Oligosaccharide binding	IDA	23319596
GO:0070828	Process	Heterochromatin organization	IMP	24239292
GO:1902455	Process	Negative regulation of stem cell population maintenance	IEA
GO:1902455	Process	Negative regulation of stem cell population maintenance	ISS

Other IDs

• MIM: 606663
• HGNC: 6666
• e!Ensembl: ENSG00000134013

Protein

• UniProt ID: Q9Y4K0
• Protein name: Lysyl oxidase homolog 2 (EC 1.4.3.13) (Lysyl oxidase-like protein 2) (Lysyl oxidase-related protein 2) (Lysyl oxidase-related protein WS9-14)
• Protein function: Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine) (PubMed:27735137). Acts as a transcription corepressor and specifically mediates deamination of
• PDB: 5ZE3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00530	SRCR	62 → 159	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	196 → 302	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	329 → 425	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	438 → 544	Scavenger receptor cysteine-rich domain	Domain
  PF01186	Lysyl_oxidase	548 → 748	Lysyl oxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues (PubMed:10212285). Highest expression in reproductive tissues, placenta, uterus and prostate (PubMed:10212285). In esophageal epithelium, expressed in the basal, prickle and granular cell layers (PubMed:222047
• Sequence:

  MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
  AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
  IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
  IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
  TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
  CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
  SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
  GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
  GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
  VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
  SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
  TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
  AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ

• Sequence length: 774

Pathways

Reactome:

Elastic fibre formation
Crosslinking of collagen fibrils

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	17394133, 18559498		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21519871, 27860390		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	2882850, 2991573		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	29759420		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	31725165		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27050073, 30976063, 31662451		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19710636, 38375886	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29089463		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30358741	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	31181019, 31436671		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	16023247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	16023247		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12670920, 19015874, 19330836, 21233336, 23933800, 23971878, 24014025, 24632622, 27655685, 27860390, 28008161, 28199967, 28332555, 28720577, 30925417		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19330836, 24014025		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21732535, 23933800, 23971878, 24014025, 28332555, 34011405, 36454513, 38518152	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27655685	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	19797161		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	30997684		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35509127	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17394133, 19015874		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21732535	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	30499665, 34011405	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23684136, 27430160, 28449718, 29728125, 29938458, 32323822, 32964626, 34206143, 36254230	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27488440, 27694892		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30976063, 32923157, 34836938	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25092917, 26096783, 26983694, 30816490, 33828127, 36314741	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21732535, 22157764, 26676674, 28332555	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	17394133		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30740823		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31802904		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31802904		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20162464, 24794791, 31322171		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29709678		★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	35292718	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26206869		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19383344, 19724858, 28246207, 29113306, 29845296		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18590575		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19383344, 26206869, 32588696, 36573458	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	31181019, 31436671		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31322171		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	25759215		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25092917, 26096783, 26983694, 30041179, 30816490		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27997555	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29077839		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28764769, 31569601		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16912508		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29930330		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29930330		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28468951		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29207131, 29930330		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16504044	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35616875	Associate	★☆☆☆☆ Found in Text Mining only
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	BEFREE	24962725		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17394133, 20043065, 31409639		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17394133, 20043065, 31409639		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37753805	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24716982, 28556501, 36995521, 37753805	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25254241	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	29746485		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28073888, 31181019, 31336025		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31725165		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29785119		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	29759420, 29930330		★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	16023247		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	16023247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular Degeneration	LHGDN	16023247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	16023247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	18381358, 30065361, 34206143, 34836938	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20026874, 27655685, 37146419	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27939076, 29053339, 30457362		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29125826	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	17287949, 29107163		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	34393991	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	27363654		★☆☆☆☆ Found in Text Mining only
Keratoderma hereditarium mutilans with ichthyosis	Keratoderma Hereditarium Mutilans With Ichthyosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29759420		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	BEFREE	30740823		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31086173		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22739041, 23684136, 27430160, 28449718, 29728125, 29938458, 30506621		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37328872	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28273952		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29052023, 30320382		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38242344	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19330836, 21233336, 23933800, 23971878, 24014025, 24632622, 27655685, 27860390, 28008161, 28199967, 28332555, 28720577, 30925417		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19330836, 24014025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17394133, 20043065, 31409639		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27488440, 27694892		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31086173		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20012301, 29959362, 31662451		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27278788, 30809541		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19625348, 31315643		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30177819		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12670920, 20818376, 25275797, 26096783, 26206869, 26329904, 26490187, 26676674, 27655685, 28677767, 28720577, 29953488, 30536539, 30925417, 31086173		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	31086173		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31802904		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26206869		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19330836, 24014025		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19330836, 24014025		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19330836, 24014025		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31426495		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	31086173		★☆☆☆☆ Found in Text Mining only
Mutilating keratoderma	Mutilating Keratoderma	BEFREE	30565282		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12670920, 17394133, 19330836, 19625348, 21519871, 23828904, 23971878, 24632622, 25092917, 25275797, 25759215, 26490187, 27430160, 27655685, 28199967, 28246206, 28449718, 28720577, 29785119, 29845296, 29953488, 30065361, 30506621, 30701028, 30786814, 30809541, 30925417, 30976063, 31061140, 31086173, 31322171, 31430136, 31662451, 31802904		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	18522746	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28468951		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21519871, 27860390, 29156517		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29990488		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28468951		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36314741	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31569601		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20012301, 29959362, 31662451		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30976063		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27285767, 29959362, 34836938	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	35246120	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	23683672	Inhibit	★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	31725165		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16023247		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	16023247		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29709678, 30153359		★☆☆☆☆ Found in Text Mining only
Progressive symmetric erythrokeratodermia	Progressive Symmetric Erythrokeratodermia	Orphanet			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27278788, 30809541		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31061140		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31061140	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15598222, 16912508, 18643845		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16504044, 28965583		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20818376, 28677767, 29052023, 29759420, 30320382		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29052023		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29732010		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26096783, 26983694, 29732010, 30816490		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29352658, 29759420		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29052023		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30218238		★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	16023247		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12820424, 18559498, 25759215, 26676674, 27860390, 28332555, 30065361, 31086173		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18559498		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22204712, 24716982, 25275797, 26980013, 27063404, 28556501, 31409639		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	24716982		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31721164, 33639646	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18559498, 26676674		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12820424, 26490187, 31219623		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31219623		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19625348, 31315643		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	19625348		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30218238		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28402931	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30177819		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30177819		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31462706		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38451841	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36555612	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32975231, 34308761	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35509127	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30499665	Associate	★☆☆☆☆ Found in Text Mining only
Vohwinkel Syndrome, Variant Form	Vohwinkel Syndrome	BEFREE	16403113		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	1712899	Associate	★☆☆☆☆ Found in Text Mining only