SAPCD1 (suppressor APC domain containing 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 401251
Gene name Suppressor APC domain containing 1
Gene symbol SAPCD1
Synonyms (NCBI Gene)
C6orf26NG23
Chromosome 6
Chromosome location 6p21.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SSQ6
Protein name Suppressor APC domain-containing protein 1 (Protein G7d)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11414 Suppressor_APC 35 → 114 Family
Sequence 
MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQ
HGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELS
RQQKGVTQPKEEMAQRGCTKGPRGPTRV
Sequence length 148
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CERVICAL CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Hemorrhagic Stroke Hemorrhagic stroke Pubtator 34727735 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Rheumatoid Arthritis Rheumatoid arthritis BEFREE 21293383
★★★★★
★☆☆☆☆
Found in Text Mining only
Sarcoma Kaposi Sarcoma Pubtator 25008864 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Takayasu Arteritis Takayasu Arteritis GWASCAT_DG 25604533
★★★★★
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Triple negative breast cancer Pubtator 35672711 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only