LNPEP (leucyl and cystinyl aminopeptidase)

Gene

• Entrez ID: 4012
• Gene name: Leucyl and cystinyl aminopeptidase
• Gene symbol: LNPEP
• Synonyms (NCBI Gene): CAP, IRAP, P-LAP, PLAP
• Chromosome: 5
• Chromosome location: 5q15
• Summary: This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023791	hsa-miR-1-3p	Proteomics	18668040
MIRT044123	hsa-miR-30e-3p	CLASH	23622248
MIRT044081	hsa-miR-361-5p	CLASH	23622248
MIRT040837	hsa-miR-18a-3p	CLASH	23622248
MIRT037514	hsa-miR-744-5p	CLASH	23622248
MIRT037306	hsa-miR-877-5p	CLASH	23622248
MIRT608154	hsa-miR-8485	HITS-CLIP	22927820
MIRT608151	hsa-miR-603	HITS-CLIP	23313552
MIRT702245	hsa-miR-8080	HITS-CLIP	23313552
MIRT702244	hsa-miR-1197	HITS-CLIP	23313552
MIRT702243	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT702242	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT702241	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT493293	hsa-miR-4302	HITS-CLIP	23313552
MIRT702240	hsa-miR-1253	HITS-CLIP	23313552
MIRT702239	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT608154	hsa-miR-8485	HITS-CLIP	23824327
MIRT656708	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656707	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT656706	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT656705	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT656704	hsa-miR-4469	HITS-CLIP	23824327
MIRT656703	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT656702	hsa-miR-5705	HITS-CLIP	23824327
MIRT656701	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656700	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT656699	hsa-miR-6844	HITS-CLIP	23824327
MIRT608154	hsa-miR-8485	HITS-CLIP	23824327
MIRT608154	hsa-miR-8485	HITS-CLIP	24906430
MIRT608153	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT608152	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT608151	hsa-miR-603	HITS-CLIP	24906430
MIRT608150	hsa-miR-3941	HITS-CLIP	24906430
MIRT608154	hsa-miR-8485	HITS-CLIP	24906430
MIRT608153	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT608152	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT608151	hsa-miR-603	HITS-CLIP	24906430
MIRT608150	hsa-miR-3941	HITS-CLIP	24906430
MIRT511221	hsa-miR-138-5p	PAR-CLIP	20371350
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT511219	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT511217	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT511209	hsa-miR-6131	PAR-CLIP	20371350
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT511206	hsa-miR-548aw	PAR-CLIP	20371350
MIRT556446	hsa-miR-5692a	PAR-CLIP	21572407
MIRT556445	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT556444	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT556443	hsa-miR-636	PAR-CLIP	21572407
MIRT556442	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT522748	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT522747	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT522746	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT522745	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522744	hsa-miR-6783-5p	PAR-CLIP	23446348
MIRT511221	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT511219	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT511217	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT511209	hsa-miR-6131	PAR-CLIP	23446348
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	23446348
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT511206	hsa-miR-548aw	PAR-CLIP	23446348
MIRT493293	hsa-miR-4302	PAR-CLIP	23592263
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493289	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493288	hsa-miR-4451	PAR-CLIP	23592263
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	23592263
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	23592263
MIRT493285	hsa-miR-3689e	PAR-CLIP	23592263
MIRT493284	hsa-miR-3689f	PAR-CLIP	23592263
MIRT493282	hsa-miR-4689	PAR-CLIP	23592263
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT493285	hsa-miR-3689e	PAR-CLIP	26701625
MIRT493284	hsa-miR-3689f	PAR-CLIP	26701625
MIRT493289	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT493293	hsa-miR-4302	PAR-CLIP	26701625
MIRT493288	hsa-miR-4451	PAR-CLIP	26701625
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT493282	hsa-miR-4689	PAR-CLIP	26701625
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT576372	hsa-miR-8485	PAR-CLIP	27292025
MIRT608151	hsa-miR-603	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	27418678
MIRT576372	hsa-miR-8485	HITS-CLIP	22927820
MIRT608151	hsa-miR-603	HITS-CLIP	23313552
MIRT702245	hsa-miR-8080	HITS-CLIP	23313552
MIRT702244	hsa-miR-1197	HITS-CLIP	23313552
MIRT702243	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT702242	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT702241	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT493293	hsa-miR-4302	HITS-CLIP	23313552
MIRT702240	hsa-miR-1253	HITS-CLIP	23313552
MIRT702239	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT576372	hsa-miR-8485	HITS-CLIP	23824327
MIRT656708	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT656707	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT656706	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT656705	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT656704	hsa-miR-4469	HITS-CLIP	23824327
MIRT656703	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT656702	hsa-miR-5705	HITS-CLIP	23824327
MIRT656701	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656700	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT656699	hsa-miR-6844	HITS-CLIP	23824327
MIRT576372	hsa-miR-8485	HITS-CLIP	23824327
MIRT511221	hsa-miR-138-5p	PAR-CLIP	20371350
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	20371350
MIRT511219	hsa-miR-152-3p	PAR-CLIP	20371350
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	20371350
MIRT511217	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	20371350
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT511209	hsa-miR-6131	PAR-CLIP	20371350
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	20371350
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT511206	hsa-miR-548aw	PAR-CLIP	20371350
MIRT556446	hsa-miR-5692a	PAR-CLIP	21572407
MIRT556445	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT556444	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT556443	hsa-miR-636	PAR-CLIP	21572407
MIRT556442	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT522748	hsa-miR-485-3p	PAR-CLIP	23446348
MIRT522747	hsa-miR-539-3p	PAR-CLIP	23446348
MIRT522746	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT522745	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522744	hsa-miR-6783-5p	PAR-CLIP	23446348
MIRT511221	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT511220	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT511219	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT511218	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT511217	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT511215	hsa-miR-4704-3p	PAR-CLIP	23446348
MIRT511216	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT511214	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT511213	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT511212	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT511211	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT511210	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT511209	hsa-miR-6131	PAR-CLIP	23446348
MIRT511208	hsa-miR-4697-3p	PAR-CLIP	23446348
MIRT511207	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT511206	hsa-miR-548aw	PAR-CLIP	23446348
MIRT493293	hsa-miR-4302	PAR-CLIP	23592263
MIRT493292	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT493291	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT493290	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT493289	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT493288	hsa-miR-4451	PAR-CLIP	23592263
MIRT493287	hsa-miR-3689a-5p	PAR-CLIP	23592263
MIRT493286	hsa-miR-3689b-5p	PAR-CLIP	23592263
MIRT493285	hsa-miR-3689e	PAR-CLIP	23592263
MIRT493284	hsa-miR-3689f	PAR-CLIP	23592263
MIRT493282	hsa-miR-4689	PAR-CLIP	23592263
MIRT493283	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT1112419	hsa-miR-1228	CLIP-seq
MIRT1112420	hsa-miR-130a	CLIP-seq
MIRT1112421	hsa-miR-130b	CLIP-seq
MIRT1112422	hsa-miR-140-3p	CLIP-seq
MIRT1112423	hsa-miR-19a	CLIP-seq
MIRT1112424	hsa-miR-19b	CLIP-seq
MIRT1112425	hsa-miR-2116	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT1112427	hsa-miR-301a	CLIP-seq
MIRT1112428	hsa-miR-301b	CLIP-seq
MIRT1112429	hsa-miR-3130-3p	CLIP-seq
MIRT1112430	hsa-miR-3145-5p	CLIP-seq
MIRT1112431	hsa-miR-3622a-3p	CLIP-seq
MIRT1112432	hsa-miR-3622b-3p	CLIP-seq
MIRT1112433	hsa-miR-3666	CLIP-seq
MIRT1112434	hsa-miR-4277	CLIP-seq
MIRT1112435	hsa-miR-4295	CLIP-seq
MIRT1112436	hsa-miR-454	CLIP-seq
MIRT1112437	hsa-miR-4793-3p	CLIP-seq
MIRT1112438	hsa-miR-544b	CLIP-seq
MIRT1112439	hsa-miR-582-5p	CLIP-seq
MIRT1112440	hsa-miR-600	CLIP-seq
MIRT1112419	hsa-miR-1228	CLIP-seq
MIRT1112441	hsa-miR-148a	CLIP-seq
MIRT1112442	hsa-miR-148b	CLIP-seq
MIRT1112443	hsa-miR-152	CLIP-seq
MIRT1112425	hsa-miR-2116	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT1112444	hsa-miR-29a	CLIP-seq
MIRT1112445	hsa-miR-29b	CLIP-seq
MIRT1112446	hsa-miR-29c	CLIP-seq
MIRT1112429	hsa-miR-3130-3p	CLIP-seq
MIRT1112447	hsa-miR-3137	CLIP-seq
MIRT1112448	hsa-miR-3148	CLIP-seq
MIRT1112431	hsa-miR-3622a-3p	CLIP-seq
MIRT1112432	hsa-miR-3622b-3p	CLIP-seq
MIRT1112449	hsa-miR-3973	CLIP-seq
MIRT1112434	hsa-miR-4277	CLIP-seq
MIRT1112437	hsa-miR-4793-3p	CLIP-seq
MIRT1112450	hsa-miR-4794	CLIP-seq
MIRT1112438	hsa-miR-544b	CLIP-seq
MIRT1112451	hsa-miR-548c-3p	CLIP-seq
MIRT1112439	hsa-miR-582-5p	CLIP-seq
MIRT1112440	hsa-miR-600	CLIP-seq
MIRT2031410	hsa-miR-125a-5p	CLIP-seq
MIRT2031411	hsa-miR-125b	CLIP-seq
MIRT2031412	hsa-miR-1291	CLIP-seq
MIRT1112420	hsa-miR-130a	CLIP-seq
MIRT1112421	hsa-miR-130b	CLIP-seq
MIRT2031413	hsa-miR-1972	CLIP-seq
MIRT1112423	hsa-miR-19a	CLIP-seq
MIRT1112424	hsa-miR-19b	CLIP-seq
MIRT1112427	hsa-miR-301a	CLIP-seq
MIRT1112428	hsa-miR-301b	CLIP-seq
MIRT1112430	hsa-miR-3145-5p	CLIP-seq
MIRT1112433	hsa-miR-3666	CLIP-seq
MIRT1112449	hsa-miR-3973	CLIP-seq
MIRT1112435	hsa-miR-4295	CLIP-seq
MIRT2031414	hsa-miR-4319	CLIP-seq
MIRT1112436	hsa-miR-454	CLIP-seq
MIRT2031415	hsa-miR-4650-5p	CLIP-seq
MIRT2031416	hsa-miR-520g	CLIP-seq
MIRT2031417	hsa-miR-520h	CLIP-seq
MIRT2031418	hsa-miR-610	CLIP-seq
MIRT2031419	hsa-miR-885-3p	CLIP-seq
MIRT2262326	hsa-miR-1255a	CLIP-seq
MIRT2262327	hsa-miR-1255b	CLIP-seq
MIRT2031410	hsa-miR-125a-5p	CLIP-seq
MIRT2031411	hsa-miR-125b	CLIP-seq
MIRT2031412	hsa-miR-1291	CLIP-seq
MIRT1112422	hsa-miR-140-3p	CLIP-seq
MIRT2031413	hsa-miR-1972	CLIP-seq
MIRT2262328	hsa-miR-3134	CLIP-seq
MIRT2031414	hsa-miR-4319	CLIP-seq
MIRT2262329	hsa-miR-4426	CLIP-seq
MIRT2262330	hsa-miR-4647	CLIP-seq
MIRT2031415	hsa-miR-4650-5p	CLIP-seq
MIRT2262331	hsa-miR-4662b	CLIP-seq
MIRT2262332	hsa-miR-511	CLIP-seq
MIRT2031418	hsa-miR-610	CLIP-seq
MIRT2430787	hsa-miR-3119	CLIP-seq
MIRT2561898	hsa-miR-1234	CLIP-seq
MIRT1112426	hsa-miR-223	CLIP-seq
MIRT2561899	hsa-miR-2355-3p	CLIP-seq
MIRT2561900	hsa-miR-3132	CLIP-seq
MIRT2561901	hsa-miR-3163	CLIP-seq
MIRT2561902	hsa-miR-320a	CLIP-seq
MIRT2561903	hsa-miR-320b	CLIP-seq
MIRT2561904	hsa-miR-320c	CLIP-seq
MIRT2561905	hsa-miR-320d	CLIP-seq
MIRT2561906	hsa-miR-3616-5p	CLIP-seq
MIRT2561907	hsa-miR-3647-5p	CLIP-seq
MIRT2561908	hsa-miR-3674	CLIP-seq
MIRT2561909	hsa-miR-374a	CLIP-seq
MIRT2561910	hsa-miR-374b	CLIP-seq
MIRT2561911	hsa-miR-3935	CLIP-seq
MIRT2561912	hsa-miR-4289	CLIP-seq
MIRT2561913	hsa-miR-4318	CLIP-seq
MIRT2561914	hsa-miR-4429	CLIP-seq
MIRT2561915	hsa-miR-4467	CLIP-seq
MIRT2561916	hsa-miR-4646-3p	CLIP-seq
MIRT2561917	hsa-miR-4693-5p	CLIP-seq
MIRT2561918	hsa-miR-4795-5p	CLIP-seq
MIRT2561919	hsa-miR-502-5p	CLIP-seq
MIRT2561920	hsa-miR-573	CLIP-seq
MIRT2561921	hsa-miR-592	CLIP-seq
MIRT2561922	hsa-miR-597	CLIP-seq
MIRT2561923	hsa-miR-892a	CLIP-seq
MIRT2561924	hsa-miR-944	CLIP-seq
MIRT2561898	hsa-miR-1234	CLIP-seq
MIRT2561900	hsa-miR-3132	CLIP-seq
MIRT2561901	hsa-miR-3163	CLIP-seq
MIRT2561902	hsa-miR-320a	CLIP-seq
MIRT2561903	hsa-miR-320b	CLIP-seq
MIRT2561904	hsa-miR-320c	CLIP-seq
MIRT2561905	hsa-miR-320d	CLIP-seq
MIRT2683953	hsa-miR-337-3p	CLIP-seq
MIRT2561906	hsa-miR-3616-5p	CLIP-seq
MIRT2561907	hsa-miR-3647-5p	CLIP-seq
MIRT2561908	hsa-miR-3674	CLIP-seq
MIRT2683954	hsa-miR-3685	CLIP-seq
MIRT2561909	hsa-miR-374a	CLIP-seq
MIRT2561910	hsa-miR-374b	CLIP-seq
MIRT2683955	hsa-miR-384	CLIP-seq
MIRT2561911	hsa-miR-3935	CLIP-seq
MIRT2561912	hsa-miR-4289	CLIP-seq
MIRT2683956	hsa-miR-4328	CLIP-seq
MIRT2561914	hsa-miR-4429	CLIP-seq
MIRT2561915	hsa-miR-4467	CLIP-seq
MIRT2683957	hsa-miR-4729	CLIP-seq
MIRT2561918	hsa-miR-4795-5p	CLIP-seq
MIRT2561919	hsa-miR-502-5p	CLIP-seq
MIRT2561920	hsa-miR-573	CLIP-seq
MIRT2561924	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TFAP2A	Activation	15894523

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002480	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS
GO:0004177	Function	Aminopeptidase activity	EXP	9668046, 11062501, 19498108, 19918052
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	TAS	15691326
GO:0005515	Function	Protein binding	IPI	12080061, 22153077, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11108258
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	8550619
GO:0007267	Process	Cell-cell signaling	TAS	8550619
GO:0007565	Process	Female pregnancy	TAS	8550619
GO:0008217	Process	Regulation of blood pressure	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9177475
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8550619
GO:0010813	Process	Neuropeptide catabolic process	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031905	Component	Early endosome lumen	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	25534853

Other IDs

• MIM: 151300
• HGNC: 6656
• e!Ensembl: ENSG00000113441

Protein

• UniProt ID: Q9UIQ6
• Protein name: Leucyl-cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Oxytocinase) (OTase) (Placental leucine aminopeptidase) (P-LAP) [Cleaved into: Leucyl-cystinyl a
• Protein function: Release of an N-terminal amino acid, cleaves before cysteine, leucine as well as other amino acids. Degrades peptide hormones such as oxytocin, vasopressin and angiotensin III, and plays a role in maintaining homeostasis during pregnancy. May be
• PDB: 4P8Q, 4PJ6, 4Z7I, 5C97, 5JHQ, 5MJ6, 7ZYF, 8CGP, 8CGW, 8P0I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17900	Peptidase_M1_N	173 → 358		Domain
  PF01433	Peptidase_M1	392 → 610	Peptidase family M1 domain	Domain
  PF11838	ERAP1_C	689 → 1009	ERAP1-like C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in placenta, heart, kidney and small intestine. Detected at lower levels in neuronal cells in the brain, in skeletal muscle, spleen, liver, testes and colon. {ECO:0000269|PubMed:11389728, ECO:0000269|PubMed:8550619, EC
• Sequence:

  MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
  HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
  AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
  LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
  GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
  SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
  FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
  AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
  NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
  EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
  LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
  EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
  YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
  KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
  KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
  EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
  YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
  LTWWL

• Sequence length: 1025

Pathways

KEGG:

Renin-angiotensin system

Reactome:

Endosomal/Vacuolar pathway
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIRDSHOT CHORIORETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute fatty liver of pregnancy	Fatty Liver	BEFREE	20953066		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	29456727		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15907336		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	15907336		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10571045		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	11730987		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	28477791		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27834335	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	21348480		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26923013		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	2624428		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	25540605, 30940621	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23897274	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22913580		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30370863		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28283809		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	1643026		★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	26418075		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	1643026		★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	GWASDB_DG	24957906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	GWASCAT_DG	24957906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	24957906, 34727153	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	19289584, 19369627, 19864236, 24698965, 25367072, 25818873, 26473483, 26754674, 27180259, 27455837, 27834335, 28764718, 30953146, 31076089, 31732618		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27834335	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	3325192		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15907336, 25133707, 3325192		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23897274		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23897274	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38001104	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31806131		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26242403		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26242403		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12569180, 14749039, 8703954		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	12569180		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30144577		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1596896		★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	12361682		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16368518		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10571045		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1386092		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	37813091	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15187412, 23897274, 31612634		★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes insipidus	Pubtator	20953066	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	29463074, 31345525		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15187412, 23897274, 31612634		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23897274	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15187412, 28225806		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	16187279		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15491750, 16187279		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17233921	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31638258		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25133707		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29108123		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27639088		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28555065		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28555065		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	20953066		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	20953066	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21858921		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	14749039		★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	29631952		★☆☆☆☆ Found in Text Mining only
Juvenile pauciarticular chronic arthritis	Pauciarticular chronic arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	17692401		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16368518, 23742296		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	20953066	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30348538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19289584, 19369627, 19864236, 24504069, 25367072, 25818873, 26223814, 26473483, 26754674, 26820945, 27180259, 27455837, 27716627, 27834335, 28764718, 30520947, 31076089, 31732618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	3325192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15907336, 3325192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28917266		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29901187		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24464224, 24551292, 31837433		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26242403		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1596896		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30241820		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	22523362		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30348538		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	11730987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	38001104	Associate	★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	19279216		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	30564623		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10440809, 15907336, 1596896, 21692598, 26242403, 26956263, 27180259, 28032917, 28192599, 30520947, 31375912, 3325192		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	29463074		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30370863		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29108123		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24389591		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	GWASCAT_DG	23603761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	30286779		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15907336		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	3325192		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23402025		★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	19136952, 20518521		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31774020		★☆☆☆☆ Found in Text Mining only
Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative	Seronegative polyarthritis	GWASCAT_DG	23603761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28917266		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31303963		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23897274		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	23897274, 34589554	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17692401		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1386092		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28035472		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	3325192		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29108123, 29463916, 31295293, 31377187, 31807383		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29901187		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	26306513		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	30527189		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	30527189		★☆☆☆☆ Found in Text Mining only