Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	401190
Gene name	Regulator of G protein signaling 7 binding protein
Gene symbol	RGS7BP
Synonyms (NCBI Gene)	R7BP
Chromosome	5
Chromosome location	5q12.3
Summary	This gene encodes a protein that binds to all members of the R7 subfamily of regulators of G protein signaling and regulates their translocation between the nucleus and the plasma membrane. The encoded protein could be regulated by reversible palmitoylati

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019141	hsa-miR-335-5p	Microarray	18185580
MIRT1304557	hsa-miR-1236	CLIP-seq
MIRT1304558	hsa-miR-1252	CLIP-seq
MIRT1304559	hsa-miR-1290	CLIP-seq
MIRT1304560	hsa-miR-2117	CLIP-seq
MIRT1304561	hsa-miR-3121-3p	CLIP-seq
MIRT1304562	hsa-miR-3167	CLIP-seq
MIRT1304563	hsa-miR-3591-5p	CLIP-seq
MIRT1304564	hsa-miR-3606	CLIP-seq
MIRT1304565	hsa-miR-3942-3p	CLIP-seq
MIRT1304566	hsa-miR-4273	CLIP-seq
MIRT1304567	hsa-miR-4328	CLIP-seq
MIRT1304568	hsa-miR-4753-3p	CLIP-seq
MIRT1304569	hsa-miR-4778-3p	CLIP-seq
MIRT1304570	hsa-miR-876-5p	CLIP-seq
MIRT1304571	hsa-miR-921	CLIP-seq
MIRT1553093	hsa-miR-513a-3p	CLIP-seq
MIRT1304567	hsa-miR-4328	CLIP-seq
MIRT2314987	hsa-miR-1273g	CLIP-seq
MIRT2314988	hsa-miR-127-5p	CLIP-seq
MIRT2314989	hsa-miR-129-5p	CLIP-seq
MIRT2314990	hsa-miR-132	CLIP-seq
MIRT2314991	hsa-miR-137	CLIP-seq
MIRT2314992	hsa-miR-1827	CLIP-seq
MIRT2314993	hsa-miR-212	CLIP-seq
MIRT2314994	hsa-miR-2467-3p	CLIP-seq
MIRT2314995	hsa-miR-3120-5p	CLIP-seq
MIRT2314996	hsa-miR-3160-5p	CLIP-seq
MIRT2314997	hsa-miR-3180-5p	CLIP-seq
MIRT2314998	hsa-miR-335	CLIP-seq
MIRT2314999	hsa-miR-340	CLIP-seq
MIRT2315000	hsa-miR-3613-5p	CLIP-seq
MIRT2315001	hsa-miR-3657	CLIP-seq
MIRT2315002	hsa-miR-370	CLIP-seq
MIRT1304565	hsa-miR-3942-3p	CLIP-seq
MIRT2315003	hsa-miR-4302	CLIP-seq
MIRT1304567	hsa-miR-4328	CLIP-seq
MIRT2315004	hsa-miR-4436b-3p	CLIP-seq
MIRT2315005	hsa-miR-4459	CLIP-seq
MIRT2315006	hsa-miR-4477a	CLIP-seq
MIRT2315007	hsa-miR-4639-5p	CLIP-seq
MIRT2315008	hsa-miR-4669	CLIP-seq
MIRT2315009	hsa-miR-4766-5p	CLIP-seq
MIRT2315010	hsa-miR-4786-3p	CLIP-seq
MIRT2315011	hsa-miR-498	CLIP-seq
MIRT2315012	hsa-miR-520d-5p	CLIP-seq
MIRT2315013	hsa-miR-524-5p	CLIP-seq
MIRT2315014	hsa-miR-568	CLIP-seq
MIRT2315015	hsa-miR-570	CLIP-seq
MIRT2315016	hsa-miR-629	CLIP-seq
MIRT2315017	hsa-miR-665	CLIP-seq
MIRT2315018	hsa-miR-765	CLIP-seq
MIRT1304567	hsa-miR-4328	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043198	Component	Dendritic shaft	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0044327	Component	Dendritic spine head	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IBA
GO:0098794	Component	Postsynapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
610890	23271	ENSG00000186479

Q6MZT1

Protein name

Regulator of G-protein signaling 7-binding protein (R7 family-binding protein)

Protein function

Regulator of G protein-coupled receptor (GPCR) signaling. Regulatory subunit of the R7-Gbeta5 complexes that acts by controlling the subcellular location of the R7-Gbeta5 complexes. When palmitoylated, it targets the R7-Gbeta5 complexes to the p

Family and domains

Sequence

MSSAPNGRKKRPSRSTRSSIFQISKPPLQSGDWERRGSGSESAHKTQRALDDCKMLVQEF
NTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPE
ICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPALED
SSSSPVDSQQHSWQVSTDIENTERDMREMKNLLSKLRETMPLPLKNQDDSSLLNLTPYPL
VRRRKRRFFGLCCLISS

Sequence length

257

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE REMODELING DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	21457877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32315120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32315120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS7BP (regulator of G protein signaling 7 binding protein)