Gene Gene information from NCBI Gene database.
Entrez ID 400961
Gene name Poly(A) binding protein interacting protein 2B
Gene symbol PAIP2B
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p13.3
Summary Most mRNAs, except for histones, contain a 3-prime poly(A) tail. Poly(A)-binding protein (PABP; see MIM 604679) enhances translation by circularizing mRNA through its interaction with the translation initiation factor EIF4G1 (MIM 600495) and the poly(A) t
miRNA miRNA information provided by mirtarbase database.
426
miRTarBase ID miRNA Experiments Reference
MIRT655515 hsa-miR-3938 HITS-CLIP 23824327
MIRT655514 hsa-miR-6715a-3p HITS-CLIP 23824327
MIRT655513 hsa-miR-186-3p HITS-CLIP 23824327
MIRT655512 hsa-miR-6752-3p HITS-CLIP 23824327
MIRT655511 hsa-miR-6747-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0000900 Function MRNA regulatory element binding translation repressor activity IDA 16804161
GO:0000900 Function MRNA regulatory element binding translation repressor activity IEA
GO:0005515 Function Protein binding IPI 16804161
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IC 16804161
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611018 29200 ENSG00000124374
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULR5
Protein name Polyadenylate-binding protein-interacting protein 2B (PABP-interacting protein 2B) (PAIP-2B) (Poly(A)-binding protein-interacting protein 2B)
Protein function Inhibits translation of capped and polyadenylated mRNAs by displacing PABPC1 from the poly(A) tail.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07145 PAM2 105 120 Ataxin-2 C-terminal region Motif
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, cervix, heart, liver, ovary, kidney, prostate and testis. {ECO:0000269|PubMed:16804161}.
Sequence
MNGSNMANTSPSVKSKEDQGLSGHDEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRC
FQEMLDEEDQDWFIPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSNLNPDAKEFIPG
EKY
Sequence length 123
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CORONARY ARTERY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Malignant neoplasm of pancreas Pancreatic cancer BEFREE 28470677
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 28470677
★☆☆☆☆
Found in Text Mining only
Metabolic Syndrome Metabolic syndrome Pubtator 37049604 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 28470677
★☆☆☆☆
Found in Text Mining only
Pancreatic carcinoma Pancreatic carcinoma BEFREE 28470677
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 28470677 Inhibit
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 28470677 Associate
★☆☆☆☆
Found in Text Mining only