LMNB1 (lamin B1)

Gene

• Entrez ID: 4001
• Gene name: Lamin B1
• Gene symbol: LMNB1
• Synonyms (NCBI Gene): ADLD, ADLDAT, LMN, LMN2, LMNB, MCPH26
• Chromosome: 5
• Chromosome location: 5q23.2
• Summary: This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript varian

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002510	hsa-miR-373-3p	Microarray	15685193
MIRT002510	hsa-miR-373-3p	Microarray;Other	15685193
MIRT022094	hsa-miR-128-3p	Sequencing	20371350
MIRT002571	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002571	hsa-miR-124-3p	Microarray	15685193
MIRT023965	hsa-miR-1-3p	Proteomics	18668040
MIRT024320	hsa-miR-215-5p	Microarray	19074876
MIRT026682	hsa-miR-192-5p	Microarray	19074876
MIRT027335	hsa-miR-101-3p	Sequencing	20371350
MIRT029849	hsa-miR-26b-5p	Microarray	19088304
MIRT044805	hsa-miR-320a	CLASH	23622248
MIRT042270	hsa-miR-484	CLASH	23622248
MIRT041285	hsa-miR-193b-3p	CLASH	23622248
MIRT702258	hsa-miR-4282	HITS-CLIP	23313552
MIRT702257	hsa-miR-3606-3p	HITS-CLIP	23313552
MIRT702256	hsa-miR-513a-3p	HITS-CLIP	23313552
MIRT702255	hsa-miR-513c-3p	HITS-CLIP	23313552
MIRT702254	hsa-miR-154-5p	HITS-CLIP	23313552
MIRT702253	hsa-miR-1248	HITS-CLIP	23313552
MIRT702252	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT094815	hsa-miR-600	HITS-CLIP	23313552
MIRT702251	hsa-miR-4297	HITS-CLIP	23313552
MIRT702250	hsa-miR-5581-5p	HITS-CLIP	23313552
MIRT094817	hsa-miR-889-3p	HITS-CLIP	23313552
MIRT702249	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT702248	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT702247	hsa-miR-7159-3p	HITS-CLIP	23313552
MIRT702246	hsa-miR-4482-3p	HITS-CLIP	23313552
MIRT574200	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT574199	hsa-miR-3915	PAR-CLIP	20371350
MIRT574198	hsa-miR-1224-5p	PAR-CLIP	20371350
MIRT574197	hsa-miR-4689	PAR-CLIP	20371350
MIRT574196	hsa-miR-6858-5p	PAR-CLIP	20371350
MIRT574195	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT574194	hsa-miR-8055	PAR-CLIP	20371350
MIRT566917	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT002571	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT566915	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT562010	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT562011	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT562009	hsa-miR-23c	PAR-CLIP	20371350
MIRT562012	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT121611	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT121612	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT311425	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT311420	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT566914	hsa-miR-3163	PAR-CLIP	20371350
MIRT566913	hsa-miR-4778-5p	PAR-CLIP	20371350
MIRT566912	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT311421	hsa-miR-10b-3p	PAR-CLIP	20371350
MIRT566911	hsa-miR-6889-3p	PAR-CLIP	20371350
MIRT566910	hsa-miR-5008-3p	PAR-CLIP	20371350
MIRT566909	hsa-miR-6737-3p	PAR-CLIP	20371350
MIRT566908	hsa-miR-7157-3p	PAR-CLIP	20371350
MIRT214144	hsa-miR-4660	PAR-CLIP	20371350
MIRT311423	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT566907	hsa-miR-636	PAR-CLIP	20371350
MIRT214146	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT214143	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT214145	hsa-miR-5047	PAR-CLIP	20371350
MIRT562008	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT214147	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT214148	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT214149	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT121611	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT311421	hsa-miR-10b-3p	PAR-CLIP	20371350
MIRT214144	hsa-miR-4660	PAR-CLIP	20371350
MIRT562012	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT562011	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT562010	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT562009	hsa-miR-23c	PAR-CLIP	20371350
MIRT214146	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT214143	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT214145	hsa-miR-5047	PAR-CLIP	20371350
MIRT562008	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT094805	hsa-miR-3123	PAR-CLIP	21572407
MIRT094809	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT094806	hsa-miR-3919	PAR-CLIP	21572407
MIRT214151	hsa-miR-3065-3p	PAR-CLIP	21572407
MIRT094810	hsa-miR-5186	PAR-CLIP	21572407
MIRT357076	hsa-miR-8086	PAR-CLIP	21572407
MIRT094804	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT094808	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT357075	hsa-miR-449c-3p	PAR-CLIP	21572407
MIRT547582	hsa-miR-6083	PAR-CLIP	21572407
MIRT094805	hsa-miR-3123	PAR-CLIP	21572407
MIRT094809	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT094806	hsa-miR-3919	PAR-CLIP	21572407
MIRT214151	hsa-miR-3065-3p	PAR-CLIP	21572407
MIRT094810	hsa-miR-5186	PAR-CLIP	21572407
MIRT094804	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT094808	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT547582	hsa-miR-6083	PAR-CLIP	21572407
MIRT536279	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT513408	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT513407	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT513406	hsa-miR-429	PAR-CLIP	22012620
MIRT513405	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT513404	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT513408	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT513407	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT513406	hsa-miR-429	PAR-CLIP	23446348
MIRT513405	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT513404	hsa-miR-4766-5p	PAR-CLIP	23446348
MIRT702258	hsa-miR-4282	HITS-CLIP	23313552
MIRT702257	hsa-miR-3606-3p	HITS-CLIP	23313552
MIRT702256	hsa-miR-513a-3p	HITS-CLIP	23313552
MIRT702255	hsa-miR-513c-3p	HITS-CLIP	23313552
MIRT702254	hsa-miR-154-5p	HITS-CLIP	23313552
MIRT702253	hsa-miR-1248	HITS-CLIP	23313552
MIRT702252	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT094815	hsa-miR-600	HITS-CLIP	23313552
MIRT702251	hsa-miR-4297	HITS-CLIP	23313552
MIRT702250	hsa-miR-5581-5p	HITS-CLIP	23313552
MIRT094817	hsa-miR-889-3p	HITS-CLIP	23313552
MIRT702249	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT702248	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT702247	hsa-miR-7159-3p	HITS-CLIP	23313552
MIRT702246	hsa-miR-4482-3p	HITS-CLIP	23313552
MIRT574200	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT574199	hsa-miR-3915	PAR-CLIP	20371350
MIRT574198	hsa-miR-1224-5p	PAR-CLIP	20371350
MIRT574197	hsa-miR-4689	PAR-CLIP	20371350
MIRT574196	hsa-miR-6858-5p	PAR-CLIP	20371350
MIRT574195	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT574194	hsa-miR-8055	PAR-CLIP	20371350
MIRT566917	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT002571	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT566915	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT562010	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT562011	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT562009	hsa-miR-23c	PAR-CLIP	20371350
MIRT562012	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT121611	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT121612	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT311425	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT311420	hsa-miR-15a-3p	PAR-CLIP	20371350
MIRT566914	hsa-miR-3163	PAR-CLIP	20371350
MIRT566913	hsa-miR-4778-5p	PAR-CLIP	20371350
MIRT566912	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT311421	hsa-miR-10b-3p	PAR-CLIP	20371350
MIRT566911	hsa-miR-6889-3p	PAR-CLIP	20371350
MIRT566910	hsa-miR-5008-3p	PAR-CLIP	20371350
MIRT566909	hsa-miR-6737-3p	PAR-CLIP	20371350
MIRT566908	hsa-miR-7157-3p	PAR-CLIP	20371350
MIRT214144	hsa-miR-4660	PAR-CLIP	20371350
MIRT311423	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT566907	hsa-miR-636	PAR-CLIP	20371350
MIRT214146	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT214143	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT214145	hsa-miR-5047	PAR-CLIP	20371350
MIRT562008	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT214147	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT214148	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT214149	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT121611	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT311421	hsa-miR-10b-3p	PAR-CLIP	20371350
MIRT214144	hsa-miR-4660	PAR-CLIP	20371350
MIRT562012	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT562011	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT562010	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT562009	hsa-miR-23c	PAR-CLIP	20371350
MIRT214146	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT214143	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT214145	hsa-miR-5047	PAR-CLIP	20371350
MIRT562008	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT094805	hsa-miR-3123	PAR-CLIP	21572407
MIRT094809	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT094806	hsa-miR-3919	PAR-CLIP	21572407
MIRT214151	hsa-miR-3065-3p	PAR-CLIP	21572407
MIRT094810	hsa-miR-5186	PAR-CLIP	21572407
MIRT357076	hsa-miR-8086	PAR-CLIP	21572407
MIRT094804	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT094808	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT357075	hsa-miR-449c-3p	PAR-CLIP	21572407
MIRT547582	hsa-miR-6083	PAR-CLIP	21572407
MIRT094805	hsa-miR-3123	PAR-CLIP	21572407
MIRT094809	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT094806	hsa-miR-3919	PAR-CLIP	21572407
MIRT214151	hsa-miR-3065-3p	PAR-CLIP	21572407
MIRT094810	hsa-miR-5186	PAR-CLIP	21572407
MIRT094804	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT094808	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT547582	hsa-miR-6083	PAR-CLIP	21572407
MIRT536279	hsa-miR-3667-5p	PAR-CLIP	22012620
MIRT513408	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT513407	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT513406	hsa-miR-429	PAR-CLIP	22012620
MIRT513405	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT513404	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT513408	hsa-miR-200b-3p	PAR-CLIP	23446348
MIRT513407	hsa-miR-200c-3p	PAR-CLIP	23446348
MIRT513406	hsa-miR-429	PAR-CLIP	23446348
MIRT513405	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT513404	hsa-miR-4766-5p	PAR-CLIP	23446348
MIRT1111736	hsa-miR-154	CLIP-seq
MIRT1111737	hsa-miR-2053	CLIP-seq
MIRT1111738	hsa-miR-2113	CLIP-seq
MIRT1111739	hsa-miR-3140-3p	CLIP-seq
MIRT1111740	hsa-miR-3185	CLIP-seq
MIRT1111741	hsa-miR-3190	CLIP-seq
MIRT1111742	hsa-miR-3675-5p	CLIP-seq
MIRT1111743	hsa-miR-3679-3p	CLIP-seq
MIRT1111744	hsa-miR-3925-5p	CLIP-seq
MIRT1111745	hsa-miR-3976	CLIP-seq
MIRT1111746	hsa-miR-4446-5p	CLIP-seq
MIRT1111747	hsa-miR-4469	CLIP-seq
MIRT1111748	hsa-miR-4503	CLIP-seq
MIRT1111749	hsa-miR-4666-5p	CLIP-seq
MIRT1111750	hsa-miR-4704-5p	CLIP-seq
MIRT1111751	hsa-miR-4752	CLIP-seq
MIRT1111752	hsa-miR-4777-5p	CLIP-seq
MIRT1111753	hsa-miR-4802-3p	CLIP-seq
MIRT1111754	hsa-miR-486-3p	CLIP-seq
MIRT1111755	hsa-miR-520a-5p	CLIP-seq
MIRT1111756	hsa-miR-520f	CLIP-seq
MIRT1111757	hsa-miR-525-5p	CLIP-seq
MIRT1111758	hsa-miR-548aa	CLIP-seq
MIRT1111759	hsa-miR-569	CLIP-seq
MIRT1111760	hsa-miR-586	CLIP-seq
MIRT1111761	hsa-miR-633	CLIP-seq
MIRT1111762	hsa-miR-759	CLIP-seq
MIRT1111763	hsa-miR-889	CLIP-seq
MIRT1111764	hsa-miR-101	CLIP-seq
MIRT1111765	hsa-miR-128	CLIP-seq
MIRT1111766	hsa-miR-1301	CLIP-seq
MIRT1111767	hsa-miR-1304	CLIP-seq
MIRT1111768	hsa-miR-140-5p	CLIP-seq
MIRT1111769	hsa-miR-1470	CLIP-seq
MIRT1111736	hsa-miR-154	CLIP-seq
MIRT1111737	hsa-miR-2053	CLIP-seq
MIRT1111770	hsa-miR-23a	CLIP-seq
MIRT1111771	hsa-miR-23b	CLIP-seq
MIRT1111772	hsa-miR-299-5p	CLIP-seq
MIRT1111773	hsa-miR-3065-5p	CLIP-seq
MIRT1111774	hsa-miR-3127-3p	CLIP-seq
MIRT1111739	hsa-miR-3140-3p	CLIP-seq
MIRT1111775	hsa-miR-3671	CLIP-seq
MIRT1111742	hsa-miR-3675-5p	CLIP-seq
MIRT1111743	hsa-miR-3679-3p	CLIP-seq
MIRT1111776	hsa-miR-3914	CLIP-seq
MIRT1111744	hsa-miR-3925-5p	CLIP-seq
MIRT1111777	hsa-miR-3928	CLIP-seq
MIRT1111745	hsa-miR-3976	CLIP-seq
MIRT1111778	hsa-miR-4276	CLIP-seq
MIRT1111779	hsa-miR-4302	CLIP-seq
MIRT1111746	hsa-miR-4446-5p	CLIP-seq
MIRT1111747	hsa-miR-4469	CLIP-seq
MIRT1111780	hsa-miR-4477a	CLIP-seq
MIRT1111748	hsa-miR-4503	CLIP-seq
MIRT1111781	hsa-miR-4511	CLIP-seq
MIRT1111749	hsa-miR-4666-5p	CLIP-seq
MIRT1111782	hsa-miR-4667-3p	CLIP-seq
MIRT1111783	hsa-miR-4672	CLIP-seq
MIRT1111784	hsa-miR-4699-3p	CLIP-seq
MIRT1111750	hsa-miR-4704-5p	CLIP-seq
MIRT1111785	hsa-miR-4760-3p	CLIP-seq
MIRT1111752	hsa-miR-4777-5p	CLIP-seq
MIRT1111753	hsa-miR-4802-3p	CLIP-seq
MIRT1111754	hsa-miR-486-3p	CLIP-seq
MIRT1111755	hsa-miR-520a-5p	CLIP-seq
MIRT1111756	hsa-miR-520f	CLIP-seq
MIRT1111786	hsa-miR-520g	CLIP-seq
MIRT1111787	hsa-miR-520h	CLIP-seq
MIRT1111757	hsa-miR-525-5p	CLIP-seq
MIRT1111788	hsa-miR-548b-3p	CLIP-seq
MIRT1111759	hsa-miR-569	CLIP-seq
MIRT1111760	hsa-miR-586	CLIP-seq
MIRT1111789	hsa-miR-607	CLIP-seq
MIRT1111761	hsa-miR-633	CLIP-seq
MIRT1111790	hsa-miR-642a	CLIP-seq
MIRT1111762	hsa-miR-759	CLIP-seq
MIRT1111763	hsa-miR-889	CLIP-seq
MIRT1111764	hsa-miR-101	CLIP-seq
MIRT1111767	hsa-miR-1304	CLIP-seq
MIRT1111737	hsa-miR-2053	CLIP-seq
MIRT1111770	hsa-miR-23a	CLIP-seq
MIRT1111771	hsa-miR-23b	CLIP-seq
MIRT1111773	hsa-miR-3065-5p	CLIP-seq
MIRT1111774	hsa-miR-3127-3p	CLIP-seq
MIRT1111776	hsa-miR-3914	CLIP-seq
MIRT1111777	hsa-miR-3928	CLIP-seq
MIRT1111778	hsa-miR-4276	CLIP-seq
MIRT1111779	hsa-miR-4302	CLIP-seq
MIRT1111747	hsa-miR-4469	CLIP-seq
MIRT1111748	hsa-miR-4503	CLIP-seq
MIRT1111749	hsa-miR-4666-5p	CLIP-seq
MIRT1111783	hsa-miR-4672	CLIP-seq
MIRT1111750	hsa-miR-4704-5p	CLIP-seq
MIRT1111785	hsa-miR-4760-3p	CLIP-seq
MIRT1111753	hsa-miR-4802-3p	CLIP-seq
MIRT1111755	hsa-miR-520a-5p	CLIP-seq
MIRT1111756	hsa-miR-520f	CLIP-seq
MIRT1111786	hsa-miR-520g	CLIP-seq
MIRT1111787	hsa-miR-520h	CLIP-seq
MIRT1111757	hsa-miR-525-5p	CLIP-seq
MIRT1111759	hsa-miR-569	CLIP-seq
MIRT1111762	hsa-miR-759	CLIP-seq
MIRT1111764	hsa-miR-101	CLIP-seq
MIRT1111766	hsa-miR-1301	CLIP-seq
MIRT1111767	hsa-miR-1304	CLIP-seq
MIRT1111769	hsa-miR-1470	CLIP-seq
MIRT1111736	hsa-miR-154	CLIP-seq
MIRT1111737	hsa-miR-2053	CLIP-seq
MIRT1111770	hsa-miR-23a	CLIP-seq
MIRT1111771	hsa-miR-23b	CLIP-seq
MIRT1111773	hsa-miR-3065-5p	CLIP-seq
MIRT1111774	hsa-miR-3127-3p	CLIP-seq
MIRT2261976	hsa-miR-3130-3p	CLIP-seq
MIRT1111739	hsa-miR-3140-3p	CLIP-seq
MIRT2261977	hsa-miR-3194-3p	CLIP-seq
MIRT2261978	hsa-miR-361-3p	CLIP-seq
MIRT1111743	hsa-miR-3679-3p	CLIP-seq
MIRT1111776	hsa-miR-3914	CLIP-seq
MIRT1111777	hsa-miR-3928	CLIP-seq
MIRT1111778	hsa-miR-4276	CLIP-seq
MIRT1111779	hsa-miR-4302	CLIP-seq
MIRT1111746	hsa-miR-4446-5p	CLIP-seq
MIRT1111747	hsa-miR-4469	CLIP-seq
MIRT1111780	hsa-miR-4477a	CLIP-seq
MIRT1111748	hsa-miR-4503	CLIP-seq
MIRT1111749	hsa-miR-4666-5p	CLIP-seq
MIRT1111782	hsa-miR-4667-3p	CLIP-seq
MIRT1111783	hsa-miR-4672	CLIP-seq
MIRT1111750	hsa-miR-4704-5p	CLIP-seq
MIRT1111785	hsa-miR-4760-3p	CLIP-seq
MIRT2261979	hsa-miR-4793-3p	CLIP-seq
MIRT1111753	hsa-miR-4802-3p	CLIP-seq
MIRT1111755	hsa-miR-520a-5p	CLIP-seq
MIRT1111756	hsa-miR-520f	CLIP-seq
MIRT1111786	hsa-miR-520g	CLIP-seq
MIRT1111787	hsa-miR-520h	CLIP-seq
MIRT1111757	hsa-miR-525-5p	CLIP-seq
MIRT2261980	hsa-miR-552	CLIP-seq
MIRT1111759	hsa-miR-569	CLIP-seq
MIRT1111761	hsa-miR-633	CLIP-seq
MIRT1111762	hsa-miR-759	CLIP-seq
MIRT2261981	hsa-miR-760	CLIP-seq
MIRT1111763	hsa-miR-889	CLIP-seq
MIRT1111785	hsa-miR-4760-3p	CLIP-seq
MIRT1111764	hsa-miR-101	CLIP-seq
MIRT1111766	hsa-miR-1301	CLIP-seq
MIRT1111767	hsa-miR-1304	CLIP-seq
MIRT1111774	hsa-miR-3127-3p	CLIP-seq
MIRT1111777	hsa-miR-3928	CLIP-seq
MIRT1111778	hsa-miR-4276	CLIP-seq
MIRT1111779	hsa-miR-4302	CLIP-seq
MIRT1111780	hsa-miR-4477a	CLIP-seq
MIRT1111783	hsa-miR-4672	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005515	Function	Protein binding	IPI	21346760, 21988832, 25158218, 26496610, 26524528, 29568061, 29997244, 30021884, 31467278, 32296183, 32814053, 33961781, 35271311, 37398436
GO:0005634	Component	Nucleus	IDA	10791971
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	21610090
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005638	Component	Lamin filament	IEA
GO:0005652	Component	Nuclear lamina	IBA
GO:0005652	Component	Nuclear lamina	IEA
GO:0005652	Component	Nuclear lamina	IEA
GO:0005652	Component	Nuclear lamina	IMP	32910914
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0006998	Process	Nuclear envelope organization	IBA
GO:0006998	Process	Nuclear envelope organization	IEA
GO:0006998	Process	Nuclear envelope organization	IMP	32910914
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007097	Process	Nuclear migration	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016363	Component	Nuclear matrix	IEA
GO:0031507	Process	Heterochromatin formation	IBA
GO:0031965	Component	Nuclear membrane	HDA	16791210
GO:0031965	Component	Nuclear membrane	IDA
GO:0031965	Component	Nuclear membrane	IEA
GO:0034399	Component	Nuclear periphery	IEA
GO:0043274	Function	Phospholipase binding	IEA
GO:0051664	Process	Nuclear pore localization	IBA
GO:0090435	Process	Protein localization to nuclear envelope	IBA
GO:0160123	Function	Structural constituent of nuclear lamina	IEA
GO:0160123	Function	Structural constituent of nuclear lamina	TAS	7557986
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 150340
• HGNC: 6637
• e!Ensembl: ENSG00000113368

Protein

• UniProt ID: P20700
• Protein name: Lamin-B1
• Protein function: Lamins are intermediate filament proteins that assemble into a filamentous meshwork, and which constitute the major components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane (PubMed:28716252, PubMe
• PDB: 2KPW, 3JT0, 3TYY, 3UMN, 5BNW, 5VVX, 7DTG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00038	Filament	31 → 387	Intermediate filament protein	Coiled-coil
  PF00932	LTD	435 → 545	Lamin Tail Domain	Domain

• Sequence:

  MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
  QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLN
  YAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAA
  KKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEY
  KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
  ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDY
  EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
  VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
  SYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA
  QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

• Sequence length: 586

Pathways

KEGG:

Apoptosis
Cytoskeleton in muscle cells

Reactome:

Formation of Senescence-Associated Heterochromatin Foci (SAHF)
Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Breakdown of the nuclear lamina
Depolymerisation of the Nuclear Lamina
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Microcephaly	Pathogenic	rs1751797979	RCV001252943	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly 26, primary, autosomal dominant	Likely pathogenic; Pathogenic	rs2479520123, rs1750497172, rs1245844735, rs935132421, rs1751587092, rs1750506249	RCV003153029 RCV001292578 RCV001292579 RCV001292576 RCV001292580 RCV001292581	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Syndrome with microcephaly as major feature	Pathogenic	rs1750497172, rs1245844735, rs935132421, rs1751587092	RCV001254641 RCV001254642 RCV001254640 RCV001254643	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adult-onset autosomal dominant demyelinating leukodystrophy	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT PRIMARY MICROCEPHALY	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukodystrophy, Adult-Onset	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LMNB1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY AUTOSOMAL DOMINANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired partial lipodystrophy	Acquired Partial Lipodystrophy	BEFREE	17467691		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31635050		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adult onset autosomal dominant leukodystrophy	Leukodystrophy	BEFREE	19287139, 23681646, 25532872, 28769756, 31695592		★☆☆☆☆ Found in Text Mining only
Adult onset autosomal dominant leukodystrophy	Leukodystrophy	ORPHANET_DG	23649844		★☆☆☆☆ Found in Text Mining only
Adult Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher Disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Adult-onset autosomal dominant leukodystrophy	Leukodystrophy	Orphanet			★☆☆☆☆ Found in Text Mining only
Agenesis of Corpus Callosum	Corpus callosum agenesis	Pubtator	32910914	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25991665	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22119712		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20352044, 28434507, 28631957, 30662429, 30666448		★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	23166514		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21778424		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	26053668	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	22246186	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21778424		★☆☆☆☆ Found in Text Mining only
Atrophy of corpus callosum	Atrophy Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrophy of the spinal cord	Atrophy of the spinal cord	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autonomic bladder dysfunction	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	19151023, 24128683		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Primary microcephaly	Pubtator	32910914, 33033404	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24293108		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24293108, 32705365, 33948615, 34237080	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34459389	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30897324, 34810266, 35436411	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34511484, 36405011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31015297		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28844980		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20796278		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	23873483	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28804121		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30692212		★☆☆☆☆ Found in Text Mining only
Cirrhosis Cryptogenic	Cirrhosis	Pubtator	30878663	Associate	★☆☆☆☆ Found in Text Mining only
Classic Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Cockayne-Pelizaeus-Merzbacher Disease	Cockayne Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29115590		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	10517909	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10517909, 29115590	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20846378, 24732130, 39390002	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31402955		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25797039		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	10749986, 23649844, 26311780		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	23873483, 35247231	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11222085		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	37451904	Associate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	19151023, 24128683		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	34438319	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29417283		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35269619, 36277723, 39411815	Associate	★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34511484	Associate	★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	11393540		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	10517909	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33956061	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	32910914	Associate	★☆☆☆☆ Found in Text Mining only
HYPERCHOLESTEROLEMIA, AUTOSOMAL RECESSIVE	Hypercholesterolemia	BEFREE	21778424		★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25756794		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32910914	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	26752409		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24990611	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32161403, 35395184	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	16951681, 17467691, 19961535, 23649844, 23676464, 23681646, 24858279, 26053668, 27854160, 30192380		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	23261988, 23439683, 23649844, 23873483, 26053668, 30192380, 32910914, 33034697	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Demyelinating, Adult-Onset, Autosomal Dominant	Demyelinating Leukodystrophy	BEFREE	19961535, 21225301, 23649844		★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Demyelinating, Adult-Onset, Autosomal Dominant	Demyelinating Leukodystrophy	GENOMICS_ENGLAND_DG	21225301, 21909802, 24357685		★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Demyelinating, Adult-Onset, Autosomal Dominant	Demyelinating Leukodystrophy	ORPHANET_DG	23649844		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19522540, 22903723, 30897324		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30897324		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10517909	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12384929	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	28804121	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	28804121	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28804121		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	29742327		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24293108		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19522540		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31015297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23857605		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31306099		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23934658, 27760841, 28804121, 29415520, 29417283, 31015297		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29115590		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29378184		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35883595	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	32910914	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly autosomal dominant	Microcephaly	Pubtator	32910914	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30692212	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35269619	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19001169, 19348623		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	22431096		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35395184	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19522540, 31015297, 31402955		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25701871, 26053668		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23166514, 23733478, 24380701		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	23733478	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24380701		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25797039	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23857605		★☆☆☆☆ Found in Text Mining only
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	17467691		★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	BEFREE	23676464		★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease, Atypical	Hypomyelinating Leukodystrophy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease, Transitional	Hypomyelinating Leukodystrophy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	21504799, 23439683		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31306099		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31306099, 34511484	Associate	★☆☆☆☆ Found in Text Mining only
Pseudobulbar Palsy	Pseudobulbar Palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30692212	Inhibit	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	11222085		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29742327		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35356902	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	39367409	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	26053668	Associate	★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	23166514		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 31 (disorder)	Spinocerebellar Ataxia	BEFREE	22287014		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10517909	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27449096	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	12384929	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35685866	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34511484	Associate	★☆☆☆☆ Found in Text Mining only