Gene Gene information from NCBI Gene database.
Entrez ID 399968
Gene name Prostate and testis expressed 4
Gene symbol PATE4
Synonyms (NCBI Gene)
PATE-B
Chromosome 11
Chromosome location 11q24.2
miRNA miRNA information provided by mirtarbase database.
190
miRTarBase ID miRNA Experiments Reference
MIRT1215028 hsa-miR-103a CLIP-seq
MIRT1215029 hsa-miR-107 CLIP-seq
MIRT1215030 hsa-miR-1260 CLIP-seq
MIRT1215031 hsa-miR-1260b CLIP-seq
MIRT1215032 hsa-miR-137 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IDA 18387948
GO:0001669 Component Acrosomal vesicle IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IDA 18387948
GO:0030548 Function Acetylcholine receptor regulator activity IDA 18387948
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C8F1
Protein name Prostate and testis expressed protein 4 (PATE-like protein B) (PATE-B)
Protein function May modulate the function of nicotinic acetylcholine receptors. May enhance sperm motility.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in prostate, testis and spinal cord. Present in the acrosomal region of sperm cells. Present in apical epithelial cells of prostatic duct. {ECO:0000269|PubMed:18387948}.
Sequence
MRKMNTLLLVSLSFLYLKEVMGLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGD
KHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFCNVF
Sequence length 98
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Neuroactive ligand-receptor interaction  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTROCYTOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aniridia Aniridia Pubtator 21423868 Associate
★☆☆☆☆
Found in Text Mining only