Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3996
Gene name	LLGL scribble cell polarity complex component 1
Gene symbol	LLGL1
Synonyms (NCBI Gene)	DLG4HUGLHUGL-1HUGL1LLGLLgl1Mgl1
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine resi

356

Show/Hide all (356)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026101	hsa-miR-196a-5p	qRT-PCR	21077158
MIRT030531	hsa-miR-24-3p	Microarray	19748357
MIRT045222	hsa-miR-186-5p	CLASH	23622248
MIRT694754	hsa-miR-3929	HITS-CLIP	23313552
MIRT694753	hsa-miR-4419b	HITS-CLIP	23313552
MIRT694752	hsa-miR-4478	HITS-CLIP	23313552
MIRT670602	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT670601	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT694751	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT670600	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT670599	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT670598	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT670597	hsa-miR-612	HITS-CLIP	23313552
MIRT670596	hsa-miR-6860	HITS-CLIP	23313552
MIRT694750	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT694749	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT694748	hsa-miR-7854-3p	HITS-CLIP	23313552
MIRT694747	hsa-miR-6134	HITS-CLIP	23313552
MIRT670595	hsa-miR-6132	HITS-CLIP	23313552
MIRT670594	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT694746	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT694745	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT694744	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT670593	hsa-miR-3622b-5p	HITS-CLIP	23313552
MIRT670592	hsa-miR-4284	HITS-CLIP	23313552
MIRT030531	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT670591	hsa-miR-4505	HITS-CLIP	23313552
MIRT670590	hsa-miR-5787	HITS-CLIP	23313552
MIRT694743	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT694742	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT694741	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT694740	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT694739	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT694738	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT670588	hsa-miR-3945	HITS-CLIP	23313552
MIRT670589	hsa-miR-4253	HITS-CLIP	23313552
MIRT670587	hsa-miR-6862-5p	HITS-CLIP	23313552
MIRT670586	hsa-miR-4492	HITS-CLIP	23313552
MIRT670585	hsa-miR-4498	HITS-CLIP	23313552
MIRT670584	hsa-miR-5001-5p	HITS-CLIP	23313552
MIRT670583	hsa-miR-762	HITS-CLIP	23313552
MIRT694737	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT694736	hsa-miR-6745	HITS-CLIP	23313552
MIRT694735	hsa-miR-6756-5p	HITS-CLIP	23313552
MIRT694734	hsa-miR-6766-5p	HITS-CLIP	23313552
MIRT694733	hsa-miR-1293	HITS-CLIP	23313552
MIRT694732	hsa-miR-4483	HITS-CLIP	23313552
MIRT694731	hsa-miR-3165	HITS-CLIP	23313552
MIRT694730	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT694729	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT694728	hsa-miR-6748-5p	HITS-CLIP	23313552
MIRT670582	hsa-miR-7977	HITS-CLIP	23313552
MIRT694727	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT694726	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT694725	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT694724	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT694723	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT694722	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT694721	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT694720	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT694719	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT694718	hsa-miR-3689c	HITS-CLIP	23313552
MIRT694717	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT694716	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT670581	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT670580	hsa-miR-3122	HITS-CLIP	23313552
MIRT670579	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT670578	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT670577	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT694715	hsa-miR-665	HITS-CLIP	23313552
MIRT670602	hsa-miR-4446-3p	HITS-CLIP	23824327
MIRT670601	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT670600	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT670599	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT670598	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT670597	hsa-miR-612	HITS-CLIP	23824327
MIRT670596	hsa-miR-6860	HITS-CLIP	23824327
MIRT670595	hsa-miR-6132	HITS-CLIP	23824327
MIRT670594	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT670593	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT670592	hsa-miR-4284	HITS-CLIP	23824327
MIRT030531	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT670591	hsa-miR-4505	HITS-CLIP	23824327
MIRT670590	hsa-miR-5787	HITS-CLIP	23824327
MIRT670588	hsa-miR-3945	HITS-CLIP	23824327
MIRT670589	hsa-miR-4253	HITS-CLIP	23824327
MIRT670587	hsa-miR-6862-5p	HITS-CLIP	23824327
MIRT670586	hsa-miR-4492	HITS-CLIP	23824327
MIRT670585	hsa-miR-4498	HITS-CLIP	23824327
MIRT670584	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT670583	hsa-miR-762	HITS-CLIP	23824327
MIRT670582	hsa-miR-7977	HITS-CLIP	23824327
MIRT670581	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT670580	hsa-miR-3122	HITS-CLIP	23824327
MIRT670579	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT670578	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT670577	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT694754	hsa-miR-3929	HITS-CLIP	23313552
MIRT694753	hsa-miR-4419b	HITS-CLIP	23313552
MIRT694752	hsa-miR-4478	HITS-CLIP	23313552
MIRT670602	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT670601	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT694751	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT670600	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT670599	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT670598	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT670597	hsa-miR-612	HITS-CLIP	23313552
MIRT670596	hsa-miR-6860	HITS-CLIP	23313552
MIRT694750	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT694749	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT694748	hsa-miR-7854-3p	HITS-CLIP	23313552
MIRT694747	hsa-miR-6134	HITS-CLIP	23313552
MIRT670595	hsa-miR-6132	HITS-CLIP	23313552
MIRT670594	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT694746	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT694745	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT694744	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT670593	hsa-miR-3622b-5p	HITS-CLIP	23313552
MIRT670592	hsa-miR-4284	HITS-CLIP	23313552
MIRT030531	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT670591	hsa-miR-4505	HITS-CLIP	23313552
MIRT670590	hsa-miR-5787	HITS-CLIP	23313552
MIRT694743	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT694742	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT694741	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT694740	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT694739	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT694738	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT670588	hsa-miR-3945	HITS-CLIP	23313552
MIRT670589	hsa-miR-4253	HITS-CLIP	23313552
MIRT670587	hsa-miR-6862-5p	HITS-CLIP	23313552
MIRT670586	hsa-miR-4492	HITS-CLIP	23313552
MIRT670585	hsa-miR-4498	HITS-CLIP	23313552
MIRT670584	hsa-miR-5001-5p	HITS-CLIP	23313552
MIRT670583	hsa-miR-762	HITS-CLIP	23313552
MIRT694737	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT694736	hsa-miR-6745	HITS-CLIP	23313552
MIRT694735	hsa-miR-6756-5p	HITS-CLIP	23313552
MIRT694734	hsa-miR-6766-5p	HITS-CLIP	23313552
MIRT694733	hsa-miR-1293	HITS-CLIP	23313552
MIRT694732	hsa-miR-4483	HITS-CLIP	23313552
MIRT694731	hsa-miR-3165	HITS-CLIP	23313552
MIRT694730	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT694729	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT694728	hsa-miR-6748-5p	HITS-CLIP	23313552
MIRT670582	hsa-miR-7977	HITS-CLIP	23313552
MIRT694727	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT694726	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT694725	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT694724	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT694723	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT694722	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT694721	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT694720	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT694719	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT694718	hsa-miR-3689c	HITS-CLIP	23313552
MIRT694717	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT694716	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT670581	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT670580	hsa-miR-3122	HITS-CLIP	23313552
MIRT670579	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT670578	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT670577	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT694715	hsa-miR-665	HITS-CLIP	23313552
MIRT670602	hsa-miR-4446-3p	HITS-CLIP	23824327
MIRT670601	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT670600	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT670599	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT670598	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT670597	hsa-miR-612	HITS-CLIP	23824327
MIRT670596	hsa-miR-6860	HITS-CLIP	23824327
MIRT670595	hsa-miR-6132	HITS-CLIP	23824327
MIRT670594	hsa-miR-6836-5p	HITS-CLIP	23824327
MIRT670593	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT670592	hsa-miR-4284	HITS-CLIP	23824327
MIRT030531	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT670591	hsa-miR-4505	HITS-CLIP	23824327
MIRT670590	hsa-miR-5787	HITS-CLIP	23824327
MIRT670588	hsa-miR-3945	HITS-CLIP	23824327
MIRT670589	hsa-miR-4253	HITS-CLIP	23824327
MIRT670587	hsa-miR-6862-5p	HITS-CLIP	23824327
MIRT670586	hsa-miR-4492	HITS-CLIP	23824327
MIRT670585	hsa-miR-4498	HITS-CLIP	23824327
MIRT670584	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT670583	hsa-miR-762	HITS-CLIP	23824327
MIRT670582	hsa-miR-7977	HITS-CLIP	23824327
MIRT670581	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT670580	hsa-miR-3122	HITS-CLIP	23824327
MIRT670579	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT670578	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT670577	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT1110838	hsa-miR-105	CLIP-seq
MIRT1110839	hsa-miR-1268	CLIP-seq
MIRT1110840	hsa-miR-1268b	CLIP-seq
MIRT1110841	hsa-miR-1285	CLIP-seq
MIRT1110842	hsa-miR-147	CLIP-seq
MIRT1110843	hsa-miR-1827	CLIP-seq
MIRT1110844	hsa-miR-1908	CLIP-seq
MIRT1110845	hsa-miR-1909	CLIP-seq
MIRT1110846	hsa-miR-1915	CLIP-seq
MIRT1110847	hsa-miR-193a-3p	CLIP-seq
MIRT1110848	hsa-miR-193b	CLIP-seq
MIRT1110849	hsa-miR-2114	CLIP-seq
MIRT1110850	hsa-miR-24	CLIP-seq
MIRT1110851	hsa-miR-296-5p	CLIP-seq
MIRT1110852	hsa-miR-298	CLIP-seq
MIRT1110853	hsa-miR-3136-3p	CLIP-seq
MIRT1110854	hsa-miR-3178	CLIP-seq
MIRT1110855	hsa-miR-3199	CLIP-seq
MIRT1110856	hsa-miR-323-5p	CLIP-seq
MIRT1110857	hsa-miR-361-3p	CLIP-seq
MIRT1110858	hsa-miR-3650	CLIP-seq
MIRT1110859	hsa-miR-3665	CLIP-seq
MIRT1110860	hsa-miR-3675-3p	CLIP-seq
MIRT1110861	hsa-miR-3689d	CLIP-seq
MIRT1110862	hsa-miR-3911	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT1110864	hsa-miR-4436b-3p	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT1110867	hsa-miR-4515	CLIP-seq
MIRT1110868	hsa-miR-4649-3p	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT1110870	hsa-miR-4684-5p	CLIP-seq
MIRT1110871	hsa-miR-4685-5p	CLIP-seq
MIRT1110872	hsa-miR-4723-5p	CLIP-seq
MIRT1110873	hsa-miR-4736	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110875	hsa-miR-4786-5p	CLIP-seq
MIRT1110876	hsa-miR-4793-5p	CLIP-seq
MIRT1110877	hsa-miR-4794	CLIP-seq
MIRT1110878	hsa-miR-541	CLIP-seq
MIRT1110879	hsa-miR-548c-3p	CLIP-seq
MIRT1110880	hsa-miR-566	CLIP-seq
MIRT1110881	hsa-miR-585	CLIP-seq
MIRT1110882	hsa-miR-644	CLIP-seq
MIRT1110883	hsa-miR-654-5p	CLIP-seq
MIRT1110884	hsa-miR-663	CLIP-seq
MIRT1110885	hsa-miR-876-3p	CLIP-seq
MIRT1110886	hsa-miR-890	CLIP-seq
MIRT2030974	hsa-miR-1273f	CLIP-seq
MIRT1110844	hsa-miR-1908	CLIP-seq
MIRT2030975	hsa-miR-3675-5p	CLIP-seq
MIRT2030976	hsa-miR-3687	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT2030977	hsa-miR-4442	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT2030978	hsa-miR-4731-5p	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110875	hsa-miR-4786-5p	CLIP-seq
MIRT1110876	hsa-miR-4793-5p	CLIP-seq
MIRT1110877	hsa-miR-4794	CLIP-seq
MIRT1110884	hsa-miR-663	CLIP-seq
MIRT2261652	hsa-miR-1273	CLIP-seq
MIRT2030974	hsa-miR-1273f	CLIP-seq
MIRT1110841	hsa-miR-1285	CLIP-seq
MIRT1110843	hsa-miR-1827	CLIP-seq
MIRT2261653	hsa-miR-1913	CLIP-seq
MIRT1110849	hsa-miR-2114	CLIP-seq
MIRT1110850	hsa-miR-24	CLIP-seq
MIRT1110852	hsa-miR-298	CLIP-seq
MIRT1110854	hsa-miR-3178	CLIP-seq
MIRT1110856	hsa-miR-323-5p	CLIP-seq
MIRT2261654	hsa-miR-324-3p	CLIP-seq
MIRT2030975	hsa-miR-3675-5p	CLIP-seq
MIRT2261655	hsa-miR-4252	CLIP-seq
MIRT2261656	hsa-miR-4313	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT1110868	hsa-miR-4649-3p	CLIP-seq
MIRT2261657	hsa-miR-4649-5p	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110875	hsa-miR-4786-5p	CLIP-seq
MIRT2261658	hsa-miR-4793-3p	CLIP-seq
MIRT1110876	hsa-miR-4793-5p	CLIP-seq
MIRT2261659	hsa-miR-508-5p	CLIP-seq
MIRT1110878	hsa-miR-541	CLIP-seq
MIRT1110880	hsa-miR-566	CLIP-seq
MIRT1110883	hsa-miR-654-5p	CLIP-seq
MIRT2261660	hsa-miR-661	CLIP-seq
MIRT2261661	hsa-miR-766	CLIP-seq
MIRT1110885	hsa-miR-876-3p	CLIP-seq
MIRT1110886	hsa-miR-890	CLIP-seq
MIRT2261652	hsa-miR-1273	CLIP-seq
MIRT2261653	hsa-miR-1913	CLIP-seq
MIRT2261654	hsa-miR-324-3p	CLIP-seq
MIRT2030975	hsa-miR-3675-5p	CLIP-seq
MIRT1110861	hsa-miR-3689d	CLIP-seq
MIRT2261655	hsa-miR-4252	CLIP-seq
MIRT2261656	hsa-miR-4313	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT2261657	hsa-miR-4649-5p	CLIP-seq
MIRT2261658	hsa-miR-4793-3p	CLIP-seq
MIRT2261659	hsa-miR-508-5p	CLIP-seq
MIRT2261660	hsa-miR-661	CLIP-seq
MIRT2261661	hsa-miR-766	CLIP-seq
MIRT1110839	hsa-miR-1268	CLIP-seq
MIRT1110840	hsa-miR-1268b	CLIP-seq
MIRT1110860	hsa-miR-3675-3p	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT1110870	hsa-miR-4684-5p	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110879	hsa-miR-548c-3p	CLIP-seq
MIRT1110881	hsa-miR-585	CLIP-seq
MIRT2261652	hsa-miR-1273	CLIP-seq
MIRT2561668	hsa-miR-3658	CLIP-seq
MIRT1110860	hsa-miR-3675-3p	CLIP-seq
MIRT2261655	hsa-miR-4252	CLIP-seq
MIRT2561669	hsa-miR-4432	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT2561670	hsa-miR-451b	CLIP-seq
MIRT2261657	hsa-miR-4649-5p	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT1110870	hsa-miR-4684-5p	CLIP-seq
MIRT2561671	hsa-miR-4696	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110875	hsa-miR-4786-5p	CLIP-seq
MIRT2261658	hsa-miR-4793-3p	CLIP-seq
MIRT1110876	hsa-miR-4793-5p	CLIP-seq
MIRT1110877	hsa-miR-4794	CLIP-seq
MIRT2261659	hsa-miR-508-5p	CLIP-seq
MIRT1110879	hsa-miR-548c-3p	CLIP-seq
MIRT2261660	hsa-miR-661	CLIP-seq
MIRT2261661	hsa-miR-766	CLIP-seq
MIRT1110839	hsa-miR-1268	CLIP-seq
MIRT1110840	hsa-miR-1268b	CLIP-seq
MIRT2261652	hsa-miR-1273	CLIP-seq
MIRT1110860	hsa-miR-3675-3p	CLIP-seq
MIRT2261655	hsa-miR-4252	CLIP-seq
MIRT2561669	hsa-miR-4432	CLIP-seq
MIRT1110863	hsa-miR-4433	CLIP-seq
MIRT1110865	hsa-miR-4459	CLIP-seq
MIRT1110866	hsa-miR-4486	CLIP-seq
MIRT2561670	hsa-miR-451b	CLIP-seq
MIRT2261657	hsa-miR-4649-5p	CLIP-seq
MIRT1110869	hsa-miR-4683	CLIP-seq
MIRT1110870	hsa-miR-4684-5p	CLIP-seq
MIRT2561671	hsa-miR-4696	CLIP-seq
MIRT1110874	hsa-miR-4768-3p	CLIP-seq
MIRT1110875	hsa-miR-4786-5p	CLIP-seq
MIRT2261658	hsa-miR-4793-3p	CLIP-seq
MIRT1110876	hsa-miR-4793-5p	CLIP-seq
MIRT1110877	hsa-miR-4794	CLIP-seq
MIRT2261659	hsa-miR-508-5p	CLIP-seq
MIRT1110879	hsa-miR-548c-3p	CLIP-seq
MIRT1110881	hsa-miR-585	CLIP-seq
MIRT2261660	hsa-miR-661	CLIP-seq
MIRT2261661	hsa-miR-766	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000137	Component	Golgi cis cisterna	ISS
GO:0000139	Component	Golgi membrane	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	ISS
GO:0005198	Function	Structural molecule activity	TAS	7542763
GO:0005515	Function	Protein binding	IPI	7542763
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	7542763
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	7542763
GO:0005886	Component	Plasma membrane	IBA
GO:0005912	Component	Adherens junction	NAS	23397623
GO:0006887	Process	Exocytosis	IEA
GO:0006893	Process	Golgi to plasma membrane transport	IBA
GO:0006893	Process	Golgi to plasma membrane transport	ISS
GO:0007409	Process	Axonogenesis	ISS
GO:0008593	Process	Regulation of Notch signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IDA	7542763
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0030864	Component	Cortical actin cytoskeleton	IDA	7542763
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0030866	Process	Cortical actin cytoskeleton organization	IDA	7542763
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0032878	Process	Regulation of establishment or maintenance of cell polarity	IBA
GO:0042995	Component	Cell projection	IEA
GO:0045159	Function	Myosin II binding	IBA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	NAS	23397623
GO:0051294	Process	Establishment of spindle orientation	IBA
GO:0065003	Process	Protein-containing complex assembly	IDA	7542763

MIM	HGNC	e!Ensembl
600966	6628	ENSG00000131899

Q15334

Protein name

Lethal(2) giant larvae protein homolog 1 (LLGL) (DLG4) (Hugl-1) (Human homolog to the D-lgl gene protein)

Protein function

Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial

PDB

8R3Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08366	LLGL	279 → 380	LLGL2	Family
PF00400	WD40	422 → 461	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease. {ECO:0000269|P

Sequence

MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKI
YGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQ
LPSRPGFDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGE
VLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVIWNQASQCVDHIFLGNQQL
ESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYGPFPCKAINKILWRNCE
SGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTRPEDEFDDPQA
LAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQ
TDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLV
LELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAA
VTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSL
RQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLS
GVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGK
EVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVH
YSCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQA
SYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSAD
TTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDEAHACAILIK

Sequence length

1064

Interactions

View interactions

	KEGG
	Hippo signaling pathway Tight junction Human papillomavirus infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (143)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	BEFREE	29565039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23277453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22843887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30747034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15509549, 25410733, 28558704, 28578378, 29851783, 30193587, 31989994, 35466940, 39210294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28598851	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31580184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27401064, 29161341, 29283464, 29614860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	25032865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25032865	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	29484270, 33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	31183671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27271353, 31358727, 31511657, 33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20952458, 27271353, 29949768, 31358727, 31511657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	20952458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29169997, 31234416, 31263190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Lateral Temporal Lobe Epilepsy	Temporal lobe epilepsy	BEFREE	15119829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15054476, 16023328, 17113057, 18033238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16023328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30836092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36654075	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	16492977, 25480331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32615164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26662669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	37834131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	24986922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19610093, 29577884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27107027, 27859797, 28828633, 28943199, 29053192, 29565039, 31720014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28754554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28979677, 30118927, 30130557, 31251981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29484270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36181111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15735678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15735678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36127319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone Dystrophy	Cone dystrophy	Pubtator	10582582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30792093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	15030493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18424056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	39210294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29343737, 31183671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	29343737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	31163225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19917299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	10582582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	26911678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	23041629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	15030493, 28492982, 29193067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	33441621, 34092786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Familial Temporal Lobe 1	Epilepsy	BEFREE	15119829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	24625695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28025327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37003407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24967941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26341367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	31687391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19726651, 28359739, 29155979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28847282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	34092786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28664509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38188159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27836791, 28487191, 28979677, 29513122, 30118927, 30130557, 30292394, 30374679, 30936983, 31251981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	19617690, 33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	28135719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29281827, 29460436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	28604739		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23277453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23277453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	27357212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31451907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19447873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26662669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	15054476, 16023328, 18033238, 21635931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16023328, 21635931, 26013316, 28645745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	15030493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26341367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22843887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17369850, 30996345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	39628686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16170365, 18074678		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16170365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19917299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25264360, 26013316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	19617690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	15054476, 16023328, 22357337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	15054476, 16023328, 22357337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	26013316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	31121196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	31753031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15219944, 15735678, 16170365, 19447873, 22843887, 23864775, 26341367, 29361610, 29467485, 30131568, 7590743		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29155979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18424056, 30130557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19610093, 29155979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29035974, 30586380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	33597769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26934648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	21184590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37834131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22843887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28346830, 30993592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31121196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30926374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30926374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular Nodular Heterotopia	BEFREE	28552558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28888982, 30108200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29343737, 31183671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30138363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11043537, 12784099, 15054476, 16023328, 16702973, 16762023, 17093888, 18033238, 18462708, 19455133, 20385374, 21151988, 21490598, 23921260, 23936182 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	18033238, 21151988, 23921260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	21490598	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26013316, 27271353, 36641432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	15030493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	9096764, 9415677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29250826, 31047919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcortical Band Heterotopia	Subcortical Band Heterotopia	BEFREE	30597194		★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	29498567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	21630115, 29671277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	15054476, 16023328, 18033238, 21635931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16023328, 28645745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	26350515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	20952458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	CTD_human_DG	20952458		★★★★★ ★☆☆☆☆ Found in Text Mining only

LLGL1 (LLGL scribble cell polarity complex component 1)