Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3993
Gene name	LLGL scribble cell polarity complex component 2
Gene symbol	LLGL2
Synonyms (NCBI Gene)	HGLHugl-2LGL2
Chromosome	17
Chromosome location	17q25.1
Summary	The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein`s ability to

147

Show/Hide all (147)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018037	hsa-miR-335-5p	Microarray	18185580
MIRT078708	hsa-miR-548ac	PAR-CLIP	21572407
MIRT078722	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT078700	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT078704	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT078707	hsa-miR-548z	PAR-CLIP	21572407
MIRT078709	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT078710	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT078711	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT078712	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT078716	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT078702	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT078705	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT078718	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT018037	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT550435	hsa-miR-4477a	PAR-CLIP	21572407
MIRT493304	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT493303	hsa-miR-1912	PAR-CLIP	23592263
MIRT493302	hsa-miR-4747-3p	PAR-CLIP	23592263
MIRT493301	hsa-miR-1324	PAR-CLIP	23592263
MIRT493300	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT493299	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT493298	hsa-miR-3202	PAR-CLIP	23592263
MIRT493297	hsa-miR-1538	PAR-CLIP	23592263
MIRT493296	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT493295	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT493294	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT078708	hsa-miR-548ac	PAR-CLIP	21572407
MIRT078722	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT078700	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT078704	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT078707	hsa-miR-548z	PAR-CLIP	21572407
MIRT078709	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT078710	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT078711	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT078712	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT078716	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT078702	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT078705	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT078718	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT018037	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT550435	hsa-miR-4477a	PAR-CLIP	21572407
MIRT493304	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT493303	hsa-miR-1912	PAR-CLIP	23592263
MIRT493302	hsa-miR-4747-3p	PAR-CLIP	23592263
MIRT493301	hsa-miR-1324	PAR-CLIP	23592263
MIRT493300	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT493299	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT493298	hsa-miR-3202	PAR-CLIP	23592263
MIRT493297	hsa-miR-1538	PAR-CLIP	23592263
MIRT493296	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT493295	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT493294	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT1110887	hsa-miR-1343	CLIP-seq
MIRT1110888	hsa-miR-188-3p	CLIP-seq
MIRT1110889	hsa-miR-1913	CLIP-seq
MIRT1110890	hsa-miR-198	CLIP-seq
MIRT1110891	hsa-miR-3130-3p	CLIP-seq
MIRT1110892	hsa-miR-3170	CLIP-seq
MIRT1110893	hsa-miR-3189-5p	CLIP-seq
MIRT1110894	hsa-miR-324-3p	CLIP-seq
MIRT1110895	hsa-miR-3545-3p	CLIP-seq
MIRT1110896	hsa-miR-3652	CLIP-seq
MIRT1110897	hsa-miR-378	CLIP-seq
MIRT1110898	hsa-miR-378b	CLIP-seq
MIRT1110899	hsa-miR-378c	CLIP-seq
MIRT1110900	hsa-miR-378d	CLIP-seq
MIRT1110901	hsa-miR-378e	CLIP-seq
MIRT1110902	hsa-miR-378f	CLIP-seq
MIRT1110903	hsa-miR-378h	CLIP-seq
MIRT1110904	hsa-miR-378i	CLIP-seq
MIRT1110905	hsa-miR-422a	CLIP-seq
MIRT1110906	hsa-miR-4252	CLIP-seq
MIRT1110907	hsa-miR-4430	CLIP-seq
MIRT1110908	hsa-miR-4438	CLIP-seq
MIRT1110909	hsa-miR-4514	CLIP-seq
MIRT1110910	hsa-miR-4645-5p	CLIP-seq
MIRT1110911	hsa-miR-4673	CLIP-seq
MIRT1110912	hsa-miR-4680-5p	CLIP-seq
MIRT1110913	hsa-miR-4692	CLIP-seq
MIRT1110914	hsa-miR-4722-3p	CLIP-seq
MIRT1110915	hsa-miR-4722-5p	CLIP-seq
MIRT1110916	hsa-miR-4757-5p	CLIP-seq
MIRT1110917	hsa-miR-4758-3p	CLIP-seq
MIRT1110918	hsa-miR-498	CLIP-seq
MIRT1110919	hsa-miR-5095	CLIP-seq
MIRT1110920	hsa-miR-532-3p	CLIP-seq
MIRT1110921	hsa-miR-940	CLIP-seq
MIRT1110922	hsa-miR-1915	CLIP-seq
MIRT1110923	hsa-miR-2278	CLIP-seq
MIRT1110924	hsa-miR-3183	CLIP-seq
MIRT1110925	hsa-miR-3190	CLIP-seq
MIRT1110926	hsa-miR-3199	CLIP-seq
MIRT1110927	hsa-miR-33a	CLIP-seq
MIRT1110928	hsa-miR-33b	CLIP-seq
MIRT1110929	hsa-miR-4279	CLIP-seq
MIRT1110930	hsa-miR-4289	CLIP-seq
MIRT1110931	hsa-miR-4436b-3p	CLIP-seq
MIRT1110932	hsa-miR-4515	CLIP-seq
MIRT1110933	hsa-miR-4652-5p	CLIP-seq
MIRT1110934	hsa-miR-4690-3p	CLIP-seq
MIRT1110935	hsa-miR-4723-3p	CLIP-seq
MIRT1110936	hsa-miR-4740-3p	CLIP-seq
MIRT1110937	hsa-miR-4752	CLIP-seq
MIRT1110938	hsa-miR-615-5p	CLIP-seq
MIRT1110939	hsa-miR-646	CLIP-seq
MIRT1110940	hsa-miR-671-5p	CLIP-seq
MIRT1110941	hsa-miR-711	CLIP-seq
MIRT2030979	hsa-miR-1291	CLIP-seq
MIRT2030980	hsa-miR-146b-3p	CLIP-seq
MIRT2030981	hsa-miR-1908	CLIP-seq
MIRT2030982	hsa-miR-1914	CLIP-seq
MIRT1110923	hsa-miR-2278	CLIP-seq
MIRT1110924	hsa-miR-3183	CLIP-seq
MIRT1110925	hsa-miR-3190	CLIP-seq
MIRT2030983	hsa-miR-331-3p	CLIP-seq
MIRT1110927	hsa-miR-33a	CLIP-seq
MIRT1110928	hsa-miR-33b	CLIP-seq
MIRT2030984	hsa-miR-361-3p	CLIP-seq
MIRT1110929	hsa-miR-4279	CLIP-seq
MIRT1110930	hsa-miR-4289	CLIP-seq
MIRT2030985	hsa-miR-4313	CLIP-seq
MIRT1110934	hsa-miR-4690-3p	CLIP-seq
MIRT1110935	hsa-miR-4723-3p	CLIP-seq
MIRT1110936	hsa-miR-4740-3p	CLIP-seq
MIRT1110937	hsa-miR-4752	CLIP-seq
MIRT1110939	hsa-miR-646	CLIP-seq
MIRT2030986	hsa-miR-663	CLIP-seq
MIRT1110940	hsa-miR-671-5p	CLIP-seq
MIRT2030987	hsa-miR-744	CLIP-seq
MIRT2261662	hsa-miR-1207-5p	CLIP-seq
MIRT1110922	hsa-miR-1915	CLIP-seq
MIRT2261663	hsa-miR-199a-3p	CLIP-seq
MIRT2261664	hsa-miR-199b-3p	CLIP-seq
MIRT2261665	hsa-miR-3129-5p	CLIP-seq
MIRT2261666	hsa-miR-4260	CLIP-seq
MIRT1110931	hsa-miR-4436b-3p	CLIP-seq
MIRT2261667	hsa-miR-4529-5p	CLIP-seq
MIRT1110934	hsa-miR-4690-3p	CLIP-seq
MIRT2261668	hsa-miR-4753-5p	CLIP-seq
MIRT1110916	hsa-miR-4757-5p	CLIP-seq
MIRT2261669	hsa-miR-4763-3p	CLIP-seq
MIRT2261670	hsa-miR-486-3p	CLIP-seq
MIRT2261671	hsa-miR-671-3p	CLIP-seq
MIRT2261672	hsa-miR-936	CLIP-seq
MIRT1110892	hsa-miR-3170	CLIP-seq
MIRT1110919	hsa-miR-5095	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001890	Process	Placenta development	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005515	Function	Protein binding	IPI	12725730, 15632202, 24513855, 30996345
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15632202
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005912	Component	Adherens junction	NAS	23397623
GO:0006887	Process	Exocytosis	IEA
GO:0006893	Process	Golgi to plasma membrane transport	IBA
GO:0008593	Process	Regulation of Notch signaling pathway	IBA
GO:0009791	Process	Post-embryonic development	IEA
GO:0015820	Process	L-leucine transport	IMP	30996345
GO:0016332	Process	Establishment or maintenance of polarity of embryonic epithelium	IEA
GO:0030165	Function	PDZ domain binding	IPI	12725730
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0032878	Process	Regulation of establishment or maintenance of cell polarity	IBA
GO:0032878	Process	Regulation of establishment or maintenance of cell polarity	IDA	12725730
GO:0035264	Process	Multicellular organism growth	IEA
GO:0045159	Function	Myosin II binding	IBA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	NAS	23397623
GO:0051294	Process	Establishment of spindle orientation	IBA
GO:0051301	Process	Cell division	IEA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA

MIM	HGNC	e!Ensembl
618483	6629	ENSG00000073350

Q6P1M3

Protein name

LLGL scribble cell polarity complex component 2 (HGL) (Lethal(2) giant larvae protein homolog 2)

Protein function

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epitheli

PDB

3WP0 , 3WP1 , 6N8P , 6N8Q , 6N8R , 6N8S , 8R3X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08366	LLGL	271 → 372	LLGL2	Family
PF00400	WD40	414 → 451	WD domain, G-beta repeat	Repeat

Sequence

MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYG
APGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLR
GPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQR
DGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIF
QGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEE
LVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQ
AVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFAD
TYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGIL
VLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIAS
CVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARN
SGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE

Sequence length

1020

Interactions

View interactions

	KEGG
	Hippo signaling pathway Tight junction Human papillomavirus infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bietti Crystalline Dystrophy	Bietti crystalline corneoretinal dystrophy	Pubtator	32302351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30996345, 7529049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36192404	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	30760857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1B	Congenital disorder of glycosylation	Pubtator	24318287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36131361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36131361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25813534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25813534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19403135, 21511255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22371884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24318287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18199550, 30996345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23864775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24337435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21874049, 29369778, 30996345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23864775, 30996345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	22371884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24337435		★★★★★ ★☆☆☆☆ Found in Text Mining only

LLGL2 (LLGL scribble cell polarity complex component 2)