Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3976
Gene name	LIF interleukin 6 family cytokine
Gene symbol	LIF
Synonyms (NCBI Gene)	CDFDIAHILDAMLPLI
Chromosome	22
Chromosome location	22q12.2
Summary	The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulato

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004325	hsa-miR-199a-5p	ELISALuciferase reporter assay	19011087
MIRT001040	hsa-miR-346	ELISALuciferase reporter assay	19011087
MIRT001039	hsa-miR-26a-5p	ELISA	19011087
MIRT004326	hsa-miR-125a-5p	ELISA	19011087
MIRT001037	hsa-miR-125b-5p	ELISA	19011087
MIRT006248	hsa-miR-223-3p	Luciferase reporter assayWestern blot	22080513
MIRT018057	hsa-miR-335-5p	Microarray	18185580
MIRT029582	hsa-miR-26b-5p	Microarray	19088304
MIRT038243	hsa-miR-330-5p	CLASH	23622248
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	19536157
MIRT721349	hsa-miR-6733-3p	HITS-CLIP	19536157
MIRT721348	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT721347	hsa-miR-4673	HITS-CLIP	19536157
MIRT004325	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT721346	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT721345	hsa-miR-5193	HITS-CLIP	19536157
MIRT721344	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT721343	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT721342	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT721341	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT721340	hsa-miR-4711-3p	HITS-CLIP	19536157
MIRT721339	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT721338	hsa-miR-4279	HITS-CLIP	19536157
MIRT721337	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT001037	hsa-miR-125b-5p	MicroarrayqRT-PCR	25472924
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	28735896
MIRT006248	hsa-miR-223-3p	qRT-PCRWestern blotting	32765695
MIRT006248	hsa-miR-223-3p	qRT-PCRWestern blotting	32765695
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	19536157
MIRT721349	hsa-miR-6733-3p	HITS-CLIP	19536157
MIRT721348	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT721347	hsa-miR-4673	HITS-CLIP	19536157
MIRT004325	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT721346	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT721345	hsa-miR-5193	HITS-CLIP	19536157
MIRT721344	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT721343	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT721342	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT721341	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT721340	hsa-miR-4711-3p	HITS-CLIP	19536157
MIRT721339	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT721338	hsa-miR-4279	HITS-CLIP	19536157
MIRT721337	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT755871	hsa-miR-1299	Luciferase reporter assayWestern blottingqRT-PCRRNA pull down assay	35481460
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT1109091	hsa-miR-181a	CLIP-seq
MIRT1109092	hsa-miR-181b	CLIP-seq
MIRT1109093	hsa-miR-181c	CLIP-seq
MIRT1109094	hsa-miR-181d	CLIP-seq
MIRT1109095	hsa-miR-3125	CLIP-seq
MIRT1109096	hsa-miR-3147	CLIP-seq
MIRT1109097	hsa-miR-3916	CLIP-seq
MIRT1109098	hsa-miR-4262	CLIP-seq
MIRT1109099	hsa-miR-4425	CLIP-seq
MIRT1109100	hsa-miR-450b-3p	CLIP-seq
MIRT1109101	hsa-miR-4520a-3p	CLIP-seq
MIRT1109102	hsa-miR-4753-5p	CLIP-seq
MIRT1109103	hsa-miR-494	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT1109105	hsa-miR-548an	CLIP-seq
MIRT1109106	hsa-miR-583	CLIP-seq
MIRT1109107	hsa-miR-769-3p	CLIP-seq
MIRT1109108	hsa-miR-941	CLIP-seq
MIRT1550741	hsa-miR-1224-3p	CLIP-seq
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT1550742	hsa-miR-3936	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT1550744	hsa-miR-4714-3p	CLIP-seq
MIRT1550745	hsa-miR-486-3p	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT1550746	hsa-miR-545	CLIP-seq
MIRT1109105	hsa-miR-548an	CLIP-seq
MIRT2030172	hsa-miR-106a	CLIP-seq
MIRT2030173	hsa-miR-106b	CLIP-seq
MIRT2030174	hsa-miR-1184	CLIP-seq
MIRT2030175	hsa-miR-1205	CLIP-seq
MIRT2030176	hsa-miR-1207-5p	CLIP-seq
MIRT2030177	hsa-miR-1254	CLIP-seq
MIRT2030178	hsa-miR-1303	CLIP-seq
MIRT2030179	hsa-miR-150	CLIP-seq
MIRT2030180	hsa-miR-17	CLIP-seq
MIRT1109091	hsa-miR-181a	CLIP-seq
MIRT1109092	hsa-miR-181b	CLIP-seq
MIRT1109093	hsa-miR-181c	CLIP-seq
MIRT1109094	hsa-miR-181d	CLIP-seq
MIRT2030181	hsa-miR-1827	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2030183	hsa-miR-20a	CLIP-seq
MIRT2030184	hsa-miR-20b	CLIP-seq
MIRT2030185	hsa-miR-223	CLIP-seq
MIRT2030186	hsa-miR-296-3p	CLIP-seq
MIRT2030187	hsa-miR-302a	CLIP-seq
MIRT2030188	hsa-miR-302b	CLIP-seq
MIRT2030189	hsa-miR-302c	CLIP-seq
MIRT2030190	hsa-miR-302d	CLIP-seq
MIRT2030191	hsa-miR-302e	CLIP-seq
MIRT2030192	hsa-miR-3116	CLIP-seq
MIRT1109095	hsa-miR-3125	CLIP-seq
MIRT2030193	hsa-miR-3136-3p	CLIP-seq
MIRT2030194	hsa-miR-3158-5p	CLIP-seq
MIRT2030195	hsa-miR-328	CLIP-seq
MIRT2030196	hsa-miR-3609	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030198	hsa-miR-3690	CLIP-seq
MIRT2030199	hsa-miR-3691-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030201	hsa-miR-372	CLIP-seq
MIRT2030202	hsa-miR-373	CLIP-seq
MIRT1109097	hsa-miR-3916	CLIP-seq
MIRT2030203	hsa-miR-3918	CLIP-seq
MIRT1109098	hsa-miR-4262	CLIP-seq
MIRT2030204	hsa-miR-4300	CLIP-seq
MIRT2030205	hsa-miR-4459	CLIP-seq
MIRT2030206	hsa-miR-4487	CLIP-seq
MIRT2030207	hsa-miR-4512	CLIP-seq
MIRT2030208	hsa-miR-4685-5p	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT2030209	hsa-miR-4690-3p	CLIP-seq
MIRT2030210	hsa-miR-4697-3p	CLIP-seq
MIRT2030211	hsa-miR-4707-5p	CLIP-seq
MIRT2030212	hsa-miR-4731-5p	CLIP-seq
MIRT2030213	hsa-miR-4763-3p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030215	hsa-miR-4796-3p	CLIP-seq
MIRT1550745	hsa-miR-486-3p	CLIP-seq
MIRT1109103	hsa-miR-494	CLIP-seq
MIRT2030216	hsa-miR-510	CLIP-seq
MIRT2030217	hsa-miR-519d	CLIP-seq
MIRT2030218	hsa-miR-520a-3p	CLIP-seq
MIRT2030219	hsa-miR-520b	CLIP-seq
MIRT2030220	hsa-miR-520c-3p	CLIP-seq
MIRT2030221	hsa-miR-520d-3p	CLIP-seq
MIRT2030222	hsa-miR-520e	CLIP-seq
MIRT2030223	hsa-miR-520f	CLIP-seq
MIRT2030224	hsa-miR-548ah	CLIP-seq
MIRT2030225	hsa-miR-765	CLIP-seq
MIRT2030226	hsa-miR-920	CLIP-seq
MIRT2030227	hsa-miR-93	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2030193	hsa-miR-3136-3p	CLIP-seq
MIRT2030195	hsa-miR-328	CLIP-seq
MIRT2030196	hsa-miR-3609	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2261044	hsa-miR-3921	CLIP-seq
MIRT2261045	hsa-miR-4303	CLIP-seq
MIRT2261046	hsa-miR-4653-5p	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT2030211	hsa-miR-4707-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030224	hsa-miR-548ah	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030174	hsa-miR-1184	CLIP-seq
MIRT2030175	hsa-miR-1205	CLIP-seq
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT2561027	hsa-miR-1245b-3p	CLIP-seq
MIRT2561028	hsa-miR-1297	CLIP-seq
MIRT2561029	hsa-miR-146b-3p	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2561030	hsa-miR-1915	CLIP-seq
MIRT2561031	hsa-miR-204	CLIP-seq
MIRT2561032	hsa-miR-211	CLIP-seq
MIRT2561033	hsa-miR-26a	CLIP-seq
MIRT2561034	hsa-miR-26b	CLIP-seq
MIRT2561035	hsa-miR-3144-5p	CLIP-seq
MIRT1109096	hsa-miR-3147	CLIP-seq
MIRT2561036	hsa-miR-3157-3p	CLIP-seq
MIRT2030194	hsa-miR-3158-5p	CLIP-seq
MIRT2561037	hsa-miR-3160-3p	CLIP-seq
MIRT2561038	hsa-miR-3173-5p	CLIP-seq
MIRT2561039	hsa-miR-3191	CLIP-seq
MIRT2561040	hsa-miR-3612	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2561041	hsa-miR-3714	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2561042	hsa-miR-3910	CLIP-seq
MIRT2030203	hsa-miR-3918	CLIP-seq
MIRT2561043	hsa-miR-3925-3p	CLIP-seq
MIRT2561044	hsa-miR-3928	CLIP-seq
MIRT2561045	hsa-miR-4292	CLIP-seq
MIRT2561046	hsa-miR-431	CLIP-seq
MIRT2561047	hsa-miR-432	CLIP-seq
MIRT1109099	hsa-miR-4425	CLIP-seq
MIRT2561048	hsa-miR-4443	CLIP-seq
MIRT2561049	hsa-miR-4457	CLIP-seq
MIRT2561050	hsa-miR-4465	CLIP-seq
MIRT2030206	hsa-miR-4487	CLIP-seq
MIRT1109100	hsa-miR-450b-3p	CLIP-seq
MIRT2030207	hsa-miR-4512	CLIP-seq
MIRT2561051	hsa-miR-4521	CLIP-seq
MIRT2561052	hsa-miR-4522	CLIP-seq
MIRT2561053	hsa-miR-4652-5p	CLIP-seq
MIRT2561054	hsa-miR-4667-5p	CLIP-seq
MIRT2030208	hsa-miR-4685-5p	CLIP-seq
MIRT2561055	hsa-miR-4700-5p	CLIP-seq
MIRT2561056	hsa-miR-4725-5p	CLIP-seq
MIRT2561057	hsa-miR-4726-3p	CLIP-seq
MIRT1109102	hsa-miR-4753-5p	CLIP-seq
MIRT2561058	hsa-miR-4755-5p	CLIP-seq
MIRT2561059	hsa-miR-4780	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2561060	hsa-miR-504	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT2561061	hsa-miR-513b	CLIP-seq
MIRT2561062	hsa-miR-548k	CLIP-seq
MIRT2561063	hsa-miR-548n	CLIP-seq
MIRT2561064	hsa-miR-558	CLIP-seq
MIRT2561065	hsa-miR-576-3p	CLIP-seq
MIRT2561066	hsa-miR-623	CLIP-seq
MIRT2561067	hsa-miR-650	CLIP-seq
MIRT1109107	hsa-miR-769-3p	CLIP-seq
MIRT2561068	hsa-miR-873	CLIP-seq
MIRT2561069	hsa-miR-874	CLIP-seq
MIRT2561070	hsa-miR-940	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
EGR2	Unknown	24007274

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	8999038
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	7957045, 20624457, 22783022
GO:0005125	Function	Cytokine activity	IEA
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IBA
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IDA	7957045
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IEA
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IPI	8999038
GO:0005515	Function	Protein binding	IPI	14527405, 16051226, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	12643274
GO:0005615	Component	Extracellular space	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006955	Process	Immune response	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	7957045, 8999038, 12643274
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7957045
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8999038
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010646	Process	Regulation of cell communication	IEA
GO:0023051	Process	Regulation of signaling	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	TAS	3143918
GO:0030324	Process	Lung development	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IMP	26723254
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	7957045
GO:0045835	Process	Negative regulation of meiotic nuclear division	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20624457, 26723254
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	26723254
GO:0046697	Process	Decidualization	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048644	Process	Muscle organ morphogenesis	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048861	Process	Leukemia inhibitory factor signaling pathway	IBA
GO:0048861	Process	Leukemia inhibitory factor signaling pathway	IDA	8999038, 12643274, 20624457, 22783022
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0060463	Process	Lung lobe morphogenesis	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0072108	Process	Positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	20624457
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	IDA	20624457
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	22783022
GO:0140013	Process	Meiotic nuclear division	IEA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	20624457
GO:2000026	Process	Regulation of multicellular organismal development	IEA

MIM	HGNC	e!Ensembl
159540	6596	ENSG00000128342

P15018

Protein name

Leukemia inhibitory factor (LIF) (Differentiation-stimulating factor) (D factor) (Melanoma-derived LPL inhibitor) (MLPLI) (Emfilermin)

Protein function

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimul

PDB

1EMR , 1PVH , 2Q7N , 7N0A , 8D6A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01291	LIF_OSM	43 → 202	LIF / OSM family	Domain

Sequence

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF

Sequence length

202

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Signaling pathways regulating pluripotency of stem cells JAK-STAT signaling pathway TNF signaling pathway		Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling IL-6-type cytokine receptor ligand interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE UROGENITAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (233)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute encephalopathy	Encephalopathy	BEFREE	31787380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15372367, 7883977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10480339, 10953340, 19907922, 25313399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	1458488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10691006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	10951288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	11730713, 12915243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	3100299		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29269518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30124738, 8148158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	1522240, 22304408, 8507220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	1522240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10632674, 1522240, 15642131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30340651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10400851, 17392578, 28493984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11284716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31562743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	31958078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30124738, 8148158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21835648, 28522403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	1932751	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1932751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11494026, 23822828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21191816, 24553191, 31553107, 9497103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21191816, 35280694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	33047901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38494064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10480339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	2470740, 35313929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21725308, 26703799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36359879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	2470740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	12796566	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	12796566	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	12410400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31218515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18042242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26746670, 28107809, 30445025, 30612292		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28391028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28391028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	23822828, 29902580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10480339, 10953340, 19907922, 25313399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26296968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26296968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	28247842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	28247842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11061559, 16125646, 21726338, 31586768, 9125195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31417248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11595063, 25913757, 30046014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29899555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25726527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34700376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	30213486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	26296968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	BEFREE	29843603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	25885043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16287174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1522240, 17477816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	PSYGENET_DG	17203511, 19269948, 20471115		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delirium	Delirium	Pubtator	37156856	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	14970834		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	31352703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	14871222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22649064, 29271384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22649064, 29271384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22649064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22649064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30446227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22649064, 30495974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28512205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	9358005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29951943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29951943, 38139260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18298054, 19545488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19545488, 26056923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21987111, 28967712	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	33891982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	1992479, 2491897, 2558855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	1992479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21664615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female Urogenital Diseases	CTD_human_DG	16002989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	31582219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Facial Dermal Dysplasias	Focal facial dermal dysplasia	Pubtator	35012573	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	23822828, 29902580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30383471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10366419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11810184, 19345330, 31723002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34987659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19345330, 31723002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28246407, 28594935, 9760066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	40322064	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	8023700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	9355965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	1458488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	10951288	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	19545488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22073257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25726527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30356064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18684446, 19545488, 21987111, 22252755, 22520363, 24690239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	19361790, 28967712	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30770344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30446227, 30664218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36193061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30446227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	25913757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22899336, 29294201, 31218515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36160033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15193492, 21084396, 32372565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	32046421	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	12942572	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14715713, 15837065		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19545488, 21567092, 26615902, 28391028, 9358005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3128791, 3490886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1932751	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25726527, 8632998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19913910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3490886	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7837815, 8095566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1458488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	33034697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18393293, 21809363, 2470740, 31821689, 8023700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29250171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2470740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	2513320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21191816, 24553191, 31553107, 9497103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29951943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31409603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21725308, 26703799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25261903, 30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20388782, 21408027, 24839931, 29269518, 31296870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28533357, 30962287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30383471, 30565675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12061840, 21191816, 22952749, 23831429, 24857661, 25913757, 26271643, 27901489, 28247842, 28952053, 29269518, 30305729, 30381327, 30504771, 30565675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28391028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25913757, 30046014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24553191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	20570039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10480339, 10953340, 19907922, 25313399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	10480339, 35159191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	1742740, 23831429, 24857661, 25885043, 28501501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25484078	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25885043, 37539569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	25885043, 40191195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	14970834		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	27638424, 27766697, 30416461, 31261841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31548569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30962287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	16263181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10214873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39865264, 8145045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16263181, 19251277, 20870461, 21835648, 26984928, 9345428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19251277, 37219933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	10842275, 31243277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10657672		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25608238, 7837815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19913910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25608238	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	2491897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1709108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	2491897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15550692, 29223542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31243277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	36159840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10480339, 11494026, 14871222, 22952749, 24347053, 24703811, 24839931, 24857661, 25885043, 25942495, 26271643, 26716902, 28247842, 28533357, 29444110 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29902580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12153570, 18506635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12153570, 19495417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	8765417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30381327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	7685627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31821689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	7883977		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	12574225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21664615		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	28865476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10632674, 1522240, 16806998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22228819, 26271643, 31615908, 8511989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	9497258		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17848619		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30305729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20388782, 21408027, 24839931, 29269518, 31296870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31296870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25118635, 33047901, 36359879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20074285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	30611552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11358282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	9153290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19545488, 21411543, 30242886, 30626233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19545488, 21411543, 35551681	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature Menopause	Premature Menopause	BEFREE	9497258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	12574225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	LHGDN	12574225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28533357, 30962287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32592689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35654787, 35821621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28297566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	28512205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19588509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1522240, 16263181, 17477816, 30804924, 30847785, 8507220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	1992479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19879916, 31261841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	12410400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	7537981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	14871222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12509453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylolisthesis	Spondylolisthesis	BEFREE	28765063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16153639, 22139443, 2470740, 2473120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29444110	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35481460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21664615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30383471, 30565675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37945798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
STUVE-WIEDEMANN SYNDROME	Stuve-Wiedemann syndrome	BEFREE	19603067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	31063977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	23407384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29038846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	12509453, 15572361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	1742740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Atresia	Tricuspid Atresia	BEFREE	29480841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	21613225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21747640	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	35012573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	18506635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29038846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	39486365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LIF (LIF interleukin 6 family cytokine)