Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3959
Gene name	Galectin 3 binding protein
Gene symbol	LGALS3BP
Synonyms (NCBI Gene)	90KBTBD17BCyCAPM2BPMAC-2-BPTANGO10Bgp90
Chromosome	17
Chromosome location	17q25.3
Summary	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency viru

170

Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007309	hsa-miR-596	Luciferase reporter assayWestern blot	23233740
MIRT007309	hsa-miR-596	Luciferase reporter assayWestern blot	23233740
MIRT024048	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT025918	hsa-miR-7-5p	Microarray	19073608
MIRT046598	hsa-miR-222-3p	CLASH	23622248
MIRT039290	hsa-miR-671-5p	CLASH	23622248
MIRT038953	hsa-miR-26b-3p	CLASH	23622248
MIRT038443	hsa-miR-296-3p	CLASH	23622248
MIRT052728	hsa-miR-1260b	CLASH	23622248
MIRT451324	hsa-miR-3974	PAR-CLIP	23592263
MIRT451323	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT451322	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT451321	hsa-miR-3125	PAR-CLIP	23592263
MIRT451320	hsa-miR-3916	PAR-CLIP	23592263
MIRT451319	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT007309	hsa-miR-596	PAR-CLIP	23592263
MIRT451318	hsa-miR-4476	PAR-CLIP	23592263
MIRT451317	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT451316	hsa-miR-4779	PAR-CLIP	23592263
MIRT451315	hsa-miR-4317	PAR-CLIP	23592263
MIRT451314	hsa-miR-151a-5p	PAR-CLIP	23592263
MIRT451313	hsa-miR-151b	PAR-CLIP	23592263
MIRT451312	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT451311	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT451310	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT451309	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451308	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT039290	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT451307	hsa-miR-4533	PAR-CLIP	23592263
MIRT451306	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT451305	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT451304	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT451303	hsa-miR-616-3p	PAR-CLIP	23592263
MIRT451302	hsa-miR-1273h-3p	PAR-CLIP	23592263
MIRT451301	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT451300	hsa-miR-3158-5p	PAR-CLIP	23592263
MIRT451324	hsa-miR-3974	PAR-CLIP	27292025
MIRT451310	hsa-miR-493-3p	PAR-CLIP	27292025
MIRT451303	hsa-miR-616-3p	PAR-CLIP	27292025
MIRT451324	hsa-miR-3974	PAR-CLIP	23592263
MIRT451323	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT451322	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT451321	hsa-miR-3125	PAR-CLIP	23592263
MIRT451320	hsa-miR-3916	PAR-CLIP	23592263
MIRT451319	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT007309	hsa-miR-596	PAR-CLIP	23592263
MIRT451318	hsa-miR-4476	PAR-CLIP	23592263
MIRT451317	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT451316	hsa-miR-4779	PAR-CLIP	23592263
MIRT451315	hsa-miR-4317	PAR-CLIP	23592263
MIRT451314	hsa-miR-151a-5p	PAR-CLIP	23592263
MIRT451313	hsa-miR-151b	PAR-CLIP	23592263
MIRT451312	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT451311	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT451310	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT451309	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451308	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT039290	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT451307	hsa-miR-4533	PAR-CLIP	23592263
MIRT451306	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT451305	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT451304	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT451303	hsa-miR-616-3p	PAR-CLIP	23592263
MIRT451302	hsa-miR-1273h-3p	PAR-CLIP	23592263
MIRT451301	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT451300	hsa-miR-3158-5p	PAR-CLIP	23592263
MIRT1550729	hsa-miR-151-5p	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2560778	hsa-miR-127-5p	CLIP-seq
MIRT2560779	hsa-miR-1294	CLIP-seq
MIRT2560780	hsa-miR-145	CLIP-seq
MIRT2560781	hsa-miR-146a	CLIP-seq
MIRT2560782	hsa-miR-146b-5p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2560783	hsa-miR-3165	CLIP-seq
MIRT2560784	hsa-miR-3190	CLIP-seq
MIRT2560785	hsa-miR-339-3p	CLIP-seq
MIRT2560786	hsa-miR-3681	CLIP-seq
MIRT2560787	hsa-miR-3934	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2560788	hsa-miR-4635	CLIP-seq
MIRT2560789	hsa-miR-4663	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2560790	hsa-miR-4710	CLIP-seq
MIRT2560791	hsa-miR-4712-5p	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2560792	hsa-miR-4738-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2560793	hsa-miR-4792	CLIP-seq
MIRT2560794	hsa-miR-4800-5p	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2560795	hsa-miR-526b	CLIP-seq
MIRT2560796	hsa-miR-541	CLIP-seq
MIRT2560797	hsa-miR-578	CLIP-seq
MIRT2560798	hsa-miR-582-3p	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2560799	hsa-miR-654-5p	CLIP-seq
MIRT2560800	hsa-miR-711	CLIP-seq
MIRT2560801	hsa-miR-770-5p	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2683877	hsa-miR-1252	CLIP-seq
MIRT2683878	hsa-miR-1273	CLIP-seq
MIRT2560778	hsa-miR-127-5p	CLIP-seq
MIRT2560779	hsa-miR-1294	CLIP-seq
MIRT2560780	hsa-miR-145	CLIP-seq
MIRT2560781	hsa-miR-146a	CLIP-seq
MIRT2560782	hsa-miR-146b-5p	CLIP-seq
MIRT1550729	hsa-miR-151-5p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2560783	hsa-miR-3165	CLIP-seq
MIRT2560784	hsa-miR-3190	CLIP-seq
MIRT2560785	hsa-miR-339-3p	CLIP-seq
MIRT2560786	hsa-miR-3681	CLIP-seq
MIRT2560787	hsa-miR-3934	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2560788	hsa-miR-4635	CLIP-seq
MIRT2560789	hsa-miR-4663	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2560790	hsa-miR-4710	CLIP-seq
MIRT2560791	hsa-miR-4712-5p	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2560792	hsa-miR-4738-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2560793	hsa-miR-4792	CLIP-seq
MIRT2560794	hsa-miR-4800-5p	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2560795	hsa-miR-526b	CLIP-seq
MIRT2560796	hsa-miR-541	CLIP-seq
MIRT2560797	hsa-miR-578	CLIP-seq
MIRT2560798	hsa-miR-582-3p	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2560799	hsa-miR-654-5p	CLIP-seq
MIRT2560800	hsa-miR-711	CLIP-seq
MIRT2560801	hsa-miR-770-5p	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2683879	hsa-miR-939	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CREB5	Repression	21132541
STAT3	Repression	18594176

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005044	Function	Scavenger receptor activity	TAS	8390986
GO:0005515	Function	Protein binding	IPI	22939624, 26618866, 28514442, 29162697, 29924966, 30833792, 32814053, 33961781, 38825040
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005615	Component	Extracellular space	TAS	8390986
GO:0006968	Process	Cellular defense response	TAS	8034587
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	8390986
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031089	Component	Platelet dense granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 21362503, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
600626	6564	ENSG00000108679

Q08380

Protein name

Galectin-3-binding protein (Basement membrane autoantigen p105) (Lectin galactoside-binding soluble 3-binding protein) (Mac-2-binding protein) (MAC2BP) (Mac-2 BP) (Tumor-associated antigen 90K)

Protein function

Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.

PDB

1BY2 , 6GFB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00530	SRCR	27 → 124	Scavenger receptor cysteine-rich domain	Domain
PF07707	BACK	260 → 360	BTB And C-terminal Kelch	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts. {ECO:0000269|PubMed:8034587, ECO:0000269|PubMed:8390986, ECO:0000269|PubMed:8757764}.

Sequence

MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAG
VVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
GYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQ
FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
KAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD

Sequence length

585

Interactions

View interactions

	Reactome
			Platelet degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (131)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28731888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31996371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	8116252		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27665173, 28627758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30530049, 31653515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11145021, 14558084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28586166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15562889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30530049, 31653515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30530049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29168311, 30557999, 31464928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21515679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	21515679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	23427166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19291534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30128700, 31392502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15378479	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	14558084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	30530049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26136428, 9495353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18729497, 19522481, 22934887, 22970241, 23181716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21515679, 35471994	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11815981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26070204, 28550167, 30381417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15492795, 23184915, 28336809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24471499, 29045505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28627758	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31752995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28731888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	30530049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28112232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31136099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	29098408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	31480612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27029022, 27973711, 28369100, 29274190, 29732647, 29737582, 30128700, 30161179, 31392502, 31574141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16518858, 19665518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16518858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16518858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21515679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21515679, 39947398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	26990490, 27973711, 29915243, 30306612, 30905065, 31393964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30128700, 31392502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29098408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21091798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28731888, 30530049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28390290, 28731888, 30530049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30530049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31019124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31752995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	36982982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	36661295	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27973711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27973711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31752995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30585730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20686364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19544526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26997642, 30161179, 30286196, 30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	26396155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26503582, 26990490, 27029022, 27300763, 27349650, 27615366, 27665173, 27973711, 28406534, 28475652, 28486931, 28621007, 28811008, 29085215, 29168311 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30848102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30848102	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30848102		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart valve disease	Cardiac valvular disease	BEFREE	29098408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27255233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	21515679	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	20186066, 26070204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31019124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31467338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23233740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26070204, 26503582, 27029022, 27355265, 27973711, 28079114, 28406534, 28537900, 28627363, 28849280, 29316028, 29491234, 29732647, 30030872, 30237482 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20186066, 26070204, 31721770, 34786828	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	26396155		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27029022, 27973711, 28369100, 29274190, 29607614, 29732647, 29737582, 30128700, 30161179, 30623996, 31392502, 31480612, 31574141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	14558084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	27355265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11980646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12404290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21436623, 31681284, 33354779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36245285	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28405179, 29233037, 31681284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	33354779, 36245285	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26136428, 27176937, 9495353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30585730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27973711, 28537900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15492795, 21515679, 23184915, 28336809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23233740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28627758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16245278, 25320078, 26503549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17131321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15492795, 16518858, 19291534, 22447108, 23443559, 27665173, 27979689, 28336809, 28390290, 28627758, 28756229, 29679592, 30553852, 7698018, 9495353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16518858, 19665518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21660451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31752995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33910911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30821848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	37400835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31035456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	36661295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30530049	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12912960, 16518858, 17131321, 22389450, 23233740, 25320078, 26136428, 29207493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18450743, 22389450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18450743, 21660451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26997642, 28369100, 29274190, 29316028, 29318378, 29633352, 29679552, 30161179, 31300805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27615366, 30161179, 30286196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33910911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19291534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28627758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27665173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11815981, 24471499, 28627758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	27665173, 28421667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29318378, 31724755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29168311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16245278, 25320078, 26503549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37186007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27075409, 28811008, 29491234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21091798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29098408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11145021, 14558084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	36982982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28448532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18646789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31302247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29849819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	28731888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17131321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17131321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31019124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28405179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	20156641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LGALS3BP (galectin 3 binding protein)