LGALS3 (galectin 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 3958
Gene name Galectin 3
Gene symbol LGALS3
Synonyms (NCBI Gene)
CBP35GAL3GALBPGALIGL31LGALS2MAC2
Chromosome 14
Chromosome location 14q22.3
Summary This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT003969 hsa-miR-424-3p Northern blotqRT-PCRWestern blot 17889671
MIRT037600 hsa-miR-744-5p CLASH 23622248
MIRT755578 hsa-miR-128-3p Luciferase reporter assayqRT-PCRWestern blot 28146425
MIRT755578 hsa-miR-128-3p Western blottingqRT-PCR 34811696
MIRT1108215 hsa-miR-1208 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
JUN Activation 16285957
RUNX1 Activation 19020999
RUNX2 Activation 19020999
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
80
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (80)
GO ID Ontology Definition Evidence Reference
GO:0001772 Component Immunological synapse IBA
GO:0001772 Component Immunological synapse IDA 19706535
GO:0002376 Process Immune system process IEA
GO:0002548 Process Monocyte chemotaxis IBA
GO:0002548 Process Monocyte chemotaxis IDA 10925302
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
153619 6563 ENSG00000131981
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17931
Protein name Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
Protein function Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during earl
PDB 1A3K , 1KJL , 1KJR , 2NMN , 2NMO , 2NN8 , 2XG3 , 3AYA , 3AYC , 3AYD , 3AYE , 3T1L , 3T1M , 3ZSJ , 3ZSK , 3ZSL , 3ZSM , 4BLI , 4BLJ , 4BM8 , 4JC1 , 4JCK , 4LBJ , 4LBK , 4LBL , 4LBM , 4LBN , 4LBO , 4R9A , 4R9B , 4R9C , 4R9D , 4RL7 , 4XBN , 5E88 , 5E89 , 5E8A , 5EXO , 5H9P , 5H9R , 5IUQ , 5NF7 , 5NF9 , 5NFA , 5NFB , 5NFC , 5OAX , 5ODY , 6B8K , 6EOG , 6EOL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00337 Gal-bind_lectin 117 → 247 Galactoside-binding lectin Domain
Tissue specificity TISSUE SPECIFICITY: A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes. {ECO:0000269|PubMed:19497882}.
Sequence 
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells
RUNX2 regulates genes involved in differentiation of myeloid cells
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
21
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (21)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (572)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acromegaly Acromegaly BEFREE 29890543
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 28456545, 31053235
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 25869099
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 27736291, 29655803, 31105032
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 30892686
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 23449638, 27736291, 28238096
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 12375039
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 20197492, 22024187, 26613889, 30535445
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 9162064
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29788922, 30674531
★★★★★
★☆☆☆☆
Found in Text Mining only