Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Gene ontology Other IDs Protein Associated diseases
Entrez ID	3957
Gene name	Galectin 2
Gene symbol	LGALS2
Synonyms (NCBI Gene)	HL14
Chromosome	22
Chromosome location	22q13.1
Summary	The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs7291467	G>A	Risk-factor	Intron variant

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0016936	Function	Galactoside binding	IBA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0043029	Process	T cell homeostasis	IDA	15356130
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15356130
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISO
GO:0098609	Process	Cell-cell adhesion	IDA	15356130
GO:1990724	Component	Galectin complex	IPI	8262940

MIM	HGNC	e!Ensembl
150571	6562	ENSG00000100079

P05162

Protein name

Galectin-2 (Gal-2) (Beta-galactoside-binding lectin L-14-II) (HL14) (Lactose-binding lectin 2) (S-Lac lectin 2)

Protein function

This protein binds beta-galactoside. Its physiological function is not yet known.

PDB

1HLC , 5DG1 , 5DG2 , 5EWS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00337	Gal-bind_lectin	4 → 130	Galactoside-binding lectin	Domain

Sequence

MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVR
GGFNMSSFKLKE

Sequence length

132

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENTEROCOLITIS, NECROTIZING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LGALS2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

LGALS2 (galectin 2)