LDHB (lactate dehydrogenase B)

Gene

• Entrez ID: 3945
• Gene name: Lactate dehydrogenase B
• Gene symbol: LDHB
• Synonyms (NCBI Gene): HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
• Chromosome: 12
• Chromosome location: 12p12.1
• Summary: This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have bee

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs118203895	C>T	Affects	Coding sequence variant, missense variant
rs118203896	T>G	Affects	Coding sequence variant, missense variant
rs118203897	T>C	Affects	Coding sequence variant, missense variant
rs267607212	A>G	Affects	Genic downstream transcript variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019875	hsa-miR-375	Microarray	20215506
MIRT050573	hsa-miR-20a-5p	CLASH	23622248
MIRT048552	hsa-miR-100-5p	CLASH	23622248
MIRT048133	hsa-miR-197-3p	CLASH	23622248
MIRT046914	hsa-miR-221-3p	CLASH	23622248
MIRT045350	hsa-miR-185-5p	CLASH	23622248
MIRT043198	hsa-miR-324-5p	CLASH	23622248
MIRT040197	hsa-miR-615-3p	CLASH	23622248
MIRT039024	hsa-miR-766-3p	CLASH	23622248
MIRT038609	hsa-miR-186-3p	CLASH	23622248
MIRT019875	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, Microarray, QRTPCR	23497265
MIRT019875	hsa-miR-375	Microarray, qRT-PCR, Western blot	22752059
MIRT054322	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054323	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054324	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2260279	hsa-miR-34b	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560432	hsa-miR-1225-3p	CLIP-seq
MIRT2560433	hsa-miR-1233	CLIP-seq
MIRT2560434	hsa-miR-1255a	CLIP-seq
MIRT2560435	hsa-miR-1255b	CLIP-seq
MIRT2560436	hsa-miR-1279	CLIP-seq
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2560437	hsa-miR-3185	CLIP-seq
MIRT2560438	hsa-miR-330-3p	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2560439	hsa-miR-338-5p	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2560440	hsa-miR-4484	CLIP-seq
MIRT2560441	hsa-miR-4509	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2560442	hsa-miR-4709-3p	CLIP-seq
MIRT2560443	hsa-miR-4716-5p	CLIP-seq
MIRT2560444	hsa-miR-4775	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560445	hsa-miR-4802-3p	CLIP-seq
MIRT2560446	hsa-miR-490-5p	CLIP-seq
MIRT2560447	hsa-miR-548an	CLIP-seq
MIRT2560448	hsa-miR-548g	CLIP-seq
MIRT2560449	hsa-miR-570	CLIP-seq
MIRT2560450	hsa-miR-590-3p	CLIP-seq
MIRT2560451	hsa-miR-640	CLIP-seq
MIRT2560432	hsa-miR-1225-3p	CLIP-seq
MIRT2560433	hsa-miR-1233	CLIP-seq
MIRT2560436	hsa-miR-1279	CLIP-seq
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2560437	hsa-miR-3185	CLIP-seq
MIRT2560438	hsa-miR-330-3p	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2560439	hsa-miR-338-5p	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2560442	hsa-miR-4709-3p	CLIP-seq
MIRT2560443	hsa-miR-4716-5p	CLIP-seq
MIRT2560444	hsa-miR-4775	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560448	hsa-miR-548g	CLIP-seq
MIRT2560450	hsa-miR-590-3p	CLIP-seq
MIRT2560451	hsa-miR-640	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004457	Function	Lactate dehydrogenase activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IBA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IDA	27618187
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	TAS	8314553
GO:0005515	Function	Protein binding	IPI	21044950, 21988832, 24725412, 25416956, 25910212, 28514442, 31515488, 32296183, 32814053, 33406399, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	27618187
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006089	Process	Lactate metabolic process	IBA
GO:0006089	Process	Lactate metabolic process	IDA	15117937
GO:0006089	Process	Lactate metabolic process	IEA
GO:0006089	Process	Lactate metabolic process	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0019674	Process	NAD+ metabolic process	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 25502805, 31515488, 32296183
GO:0042867	Process	Pyruvate catabolic process	IBA
GO:0045121	Component	Membrane raft	IDA	25204797
GO:0051287	Function	NAD binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:1990204	Component	Oxidoreductase complex	IPI	15117937
GO:1990204	Component	Oxidoreductase complex	ISS

Other IDs

• MIM: 150100
• HGNC: 6541
• e!Ensembl: ENSG00000111716

Protein

• UniProt ID: P07195
• Protein name: L-lactate dehydrogenase B chain (LDH-B) (EC 1.1.1.27) (LDH heart subunit) (LDH-H) (Renal carcinoma antigen NY-REN-46)
• Protein function: Interconverts simultaneously and stereospecifically pyruvate and lactate with concomitant interconversion of NADH and NAD(+).
• PDB: 1I0Z, 1T2F, 7DBJ, 7DBK, 8QDE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00056	Ldh_1_N	22 → 161	lactate/malate dehydrogenase, NAD binding domain	Family
  PF02866	Ldh_1_C	164 → 334	lactate/malate dehydrogenase, alpha/beta C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in aerobic tissues such as cardiac muscle. {ECO:0000305|PubMed:11276087}.
• Sequence:

  MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
  GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
  IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
  IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
  EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
  LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

• Sequence length: 334

Pathways

KEGG:

Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
HIF-1 signaling pathway
Glucagon signaling pathway
Central carbon metabolism in cancer

Reactome:

Pyruvate metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, INTRADUCTAL, NONINFILTRATING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen storage disease due to lactate dehydrogenase H-subunit deficiency	Affects; Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar ClinVar, GenCC, Orphanet ClinVar, GenCC, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LDHB-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	30923124	Associate	★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23224736, 28756978, 6948128		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23224736, 25620379		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37545529	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26657874		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29289663		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25266796		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23139210, 23437403, 23697991, 29463261		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	34092577	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21177384, 23437403, 23697991, 25575825, 34092577	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	28756978		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	33565425	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26426634, 30923124, 33237575, 37803338	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25266796		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23224736		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37547725	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34176927	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22726388	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18789002		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25620379, 26735579, 30443978, 30745849		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30745849, 31424671, 33994363	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	7316481		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30831097		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33553434	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease due to lactate dehydrogenase H-subunit deficiency	Glycogen Storage Disease	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hypoxia	Hypoxia	Pubtator	34176927, 37653539	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34711218, 37653539	Associate	★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	CTD_human_DG	2334429		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	26657874		★☆☆☆☆ Found in Text Mining only
Lactate Dehydrogenase B Deficiency	Lactate Dehydrogenase B Deficiency	UNIPROT_DG	10211631, 11509017, 1587525, 2334429, 8314553, 8462975, 8611651, 9929983		★☆☆☆☆ Found in Text Mining only
Lactate Dehydrogenase B Deficiency	Lactate Dehydrogenase B Deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Lactate Dehydrogenase B Deficiency	Lactate Dehydrogenase B Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lactate Dehydrogenase B Deficiency	Lactate Dehydrogenase B Deficiency	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21356207		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21356207		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23224736		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34334381	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26426634	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23139210, 23437403, 23697991, 29463261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23224736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25807933, 30419950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16547507, 29891507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25266796		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16547507, 21177384, 21356207, 25807933, 27622334, 29463261, 30443978		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18789002		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	18593994		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18593994	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39213172	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30441870		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25575825	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30923124	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	40483507	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	23697991	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14578171, 22752059, 23139210, 23224736, 25266796, 25501018, 26657874, 27666658, 31035592, 31804482		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29925504		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31511046	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28756978, 30453281, 31180527		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	CTD_human_DG	23437403		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39587817	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25807933, 30419950		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12555229		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	17178662		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16547507, 29891507		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29891507, 35242214	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	22991145		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25973606, 28756978		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22752059, 25501018		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25973606	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	33565425	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33792181	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23139210		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25266796	Associate	★☆☆☆☆ Found in Text Mining only