LDHA (lactate dehydrogenase A)

Gene

• Entrez ID: 3939
• Gene name: Lactate dehydrogenase A
• Gene symbol: LDHA
• Synonyms (NCBI Gene): GSD11, HEL-S-133P, LDHM, PIG19
• Chromosome: 11
• Chromosome location: 11p15.1
• Summary: The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025431	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT028212	hsa-miR-33a-5p	Sequencing	20371350
MIRT051827	hsa-let-7c-5p	CLASH	23622248
MIRT050430	hsa-miR-23a-3p	CLASH	23622248
MIRT043959	hsa-miR-378a-3p	CLASH	23622248
MIRT043554	hsa-miR-331-3p	CLASH	23622248
MIRT043068	hsa-miR-324-5p	CLASH	23622248
MIRT036678	hsa-miR-935	CLASH	23622248
MIRT036157	hsa-miR-320c	CLASH	23622248
MIRT050430	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054320	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054321	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT702292	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT702295	hsa-miR-8080	HITS-CLIP	23313552
MIRT702294	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT702293	hsa-miR-577	HITS-CLIP	23313552
MIRT702292	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT702291	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT702290	hsa-miR-302a-5p	HITS-CLIP	23313552
MIRT656755	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT656756	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT656754	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT656753	hsa-miR-4284	HITS-CLIP	23824327
MIRT054320	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT656752	hsa-miR-4713-3p	HITS-CLIP	23824327
MIRT656751	hsa-miR-638	HITS-CLIP	23824327
MIRT656750	hsa-miR-4654	HITS-CLIP	23824327
MIRT656749	hsa-miR-4769-5p	HITS-CLIP	23824327
MIRT656748	hsa-miR-8057	HITS-CLIP	23824327
MIRT656747	hsa-miR-450b-3p	HITS-CLIP	23824327
MIRT656746	hsa-miR-769-3p	HITS-CLIP	23824327
MIRT504908	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT504907	hsa-miR-5190	PAR-CLIP	23446348
MIRT504906	hsa-miR-1252-5p	PAR-CLIP	23446348
MIRT367770	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT367768	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT504905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504904	hsa-miR-4276	PAR-CLIP	23446348
MIRT265634	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT332416	hsa-miR-425-5p	PAR-CLIP	23592263
MIRT265632	hsa-miR-4305	PAR-CLIP	23592263
MIRT265630	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT332419	hsa-miR-3913-3p	PAR-CLIP	23592263
MIRT474211	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT474210	hsa-miR-190b	PAR-CLIP	23592263
MIRT332417	hsa-miR-489-3p	PAR-CLIP	23592263
MIRT025431	hsa-miR-34a-5p	Luciferase reporter assay	26902416
MIRT025431	hsa-miR-34a-5p	Luciferase reporter assay	26902416
MIRT732042	hsa-miR-34a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27186405
MIRT732042	hsa-miR-34a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27186405
MIRT732042	hsa-miR-34a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25333573
MIRT025431	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT025431	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT025431	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT025431	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT702292	hsa-miR-383-5p	Luciferase reporter assay, qRT-PCR	31637133
MIRT736695	hsa-miR-329-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33058436
MIRT702292	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT702295	hsa-miR-8080	HITS-CLIP	23313552
MIRT702294	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT702293	hsa-miR-577	HITS-CLIP	23313552
MIRT702292	hsa-miR-383-5p	HITS-CLIP	23313552
MIRT702291	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT702290	hsa-miR-302a-5p	HITS-CLIP	23313552
MIRT656755	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT656756	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT656754	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT656753	hsa-miR-4284	HITS-CLIP	23824327
MIRT054320	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT656752	hsa-miR-4713-3p	HITS-CLIP	23824327
MIRT656751	hsa-miR-638	HITS-CLIP	23824327
MIRT656750	hsa-miR-4654	HITS-CLIP	23824327
MIRT656749	hsa-miR-4769-5p	HITS-CLIP	23824327
MIRT656748	hsa-miR-8057	HITS-CLIP	23824327
MIRT656747	hsa-miR-450b-3p	HITS-CLIP	23824327
MIRT656746	hsa-miR-769-3p	HITS-CLIP	23824327
MIRT504908	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT504907	hsa-miR-5190	PAR-CLIP	23446348
MIRT504906	hsa-miR-1252-5p	PAR-CLIP	23446348
MIRT367770	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT367768	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT504905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504904	hsa-miR-4276	PAR-CLIP	23446348
MIRT265634	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT332416	hsa-miR-425-5p	PAR-CLIP	23592263
MIRT265632	hsa-miR-4305	PAR-CLIP	23592263
MIRT265630	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT332419	hsa-miR-3913-3p	PAR-CLIP	23592263
MIRT474211	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT474210	hsa-miR-190b	PAR-CLIP	23592263
MIRT332417	hsa-miR-489-3p	PAR-CLIP	23592263
MIRT332417	hsa-miR-489-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34868902
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT1106285	hsa-miR-1243	CLIP-seq
MIRT1106286	hsa-miR-1261	CLIP-seq
MIRT1106287	hsa-miR-1265	CLIP-seq
MIRT1106288	hsa-miR-1269	CLIP-seq
MIRT1106289	hsa-miR-1269b	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106291	hsa-miR-134	CLIP-seq
MIRT1106292	hsa-miR-141	CLIP-seq
MIRT1106293	hsa-miR-1915	CLIP-seq
MIRT1106294	hsa-miR-200a	CLIP-seq
MIRT1106295	hsa-miR-297	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106301	hsa-miR-3118	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106304	hsa-miR-3148	CLIP-seq
MIRT1106305	hsa-miR-3149	CLIP-seq
MIRT1106306	hsa-miR-3153	CLIP-seq
MIRT1106307	hsa-miR-3164	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106309	hsa-miR-323-3p	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106311	hsa-miR-33a	CLIP-seq
MIRT1106312	hsa-miR-33b	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106314	hsa-miR-3614-5p	CLIP-seq
MIRT1106315	hsa-miR-3668	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106317	hsa-miR-377	CLIP-seq
MIRT1106318	hsa-miR-3935	CLIP-seq
MIRT1106319	hsa-miR-409-3p	CLIP-seq
MIRT1106320	hsa-miR-410	CLIP-seq
MIRT1106321	hsa-miR-4259	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106324	hsa-miR-4501	CLIP-seq
MIRT1106325	hsa-miR-4528	CLIP-seq
MIRT1106326	hsa-miR-4529-3p	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT1106329	hsa-miR-4668-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106331	hsa-miR-4709-3p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106333	hsa-miR-4715-5p	CLIP-seq
MIRT1106334	hsa-miR-4726-3p	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1106336	hsa-miR-4764-5p	CLIP-seq
MIRT1106337	hsa-miR-4781-3p	CLIP-seq
MIRT1106338	hsa-miR-4789-5p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106340	hsa-miR-567	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106344	hsa-miR-890	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT1106285	hsa-miR-1243	CLIP-seq
MIRT1106286	hsa-miR-1261	CLIP-seq
MIRT1106287	hsa-miR-1265	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106291	hsa-miR-134	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106293	hsa-miR-1915	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106295	hsa-miR-297	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106301	hsa-miR-3118	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106305	hsa-miR-3149	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106307	hsa-miR-3164	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106309	hsa-miR-323-3p	CLIP-seq
MIRT1106311	hsa-miR-33a	CLIP-seq
MIRT1106312	hsa-miR-33b	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106315	hsa-miR-3668	CLIP-seq
MIRT1106349	hsa-miR-3680	CLIP-seq
MIRT1106318	hsa-miR-3935	CLIP-seq
MIRT1106321	hsa-miR-4259	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106324	hsa-miR-4501	CLIP-seq
MIRT1106325	hsa-miR-4528	CLIP-seq
MIRT1106350	hsa-miR-455-3p	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106351	hsa-miR-4704-5p	CLIP-seq
MIRT1106333	hsa-miR-4715-5p	CLIP-seq
MIRT1106352	hsa-miR-4719	CLIP-seq
MIRT1106334	hsa-miR-4726-3p	CLIP-seq
MIRT1106336	hsa-miR-4764-5p	CLIP-seq
MIRT1106338	hsa-miR-4789-5p	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106357	hsa-miR-513b	CLIP-seq
MIRT1106340	hsa-miR-567	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1550699	hsa-miR-3691-5p	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106352	hsa-miR-4719	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1550700	hsa-miR-4752	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106357	hsa-miR-513b	CLIP-seq
MIRT1550701	hsa-miR-520d-5p	CLIP-seq
MIRT1550702	hsa-miR-524-5p	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT1106285	hsa-miR-1243	CLIP-seq
MIRT2029418	hsa-miR-1252	CLIP-seq
MIRT1106287	hsa-miR-1265	CLIP-seq
MIRT1106288	hsa-miR-1269	CLIP-seq
MIRT1106289	hsa-miR-1269b	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106291	hsa-miR-134	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106293	hsa-miR-1915	CLIP-seq
MIRT2029419	hsa-miR-219-1-3p	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106301	hsa-miR-3118	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106304	hsa-miR-3148	CLIP-seq
MIRT1106306	hsa-miR-3153	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106307	hsa-miR-3164	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106349	hsa-miR-3680	CLIP-seq
MIRT1550699	hsa-miR-3691-5p	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106317	hsa-miR-377	CLIP-seq
MIRT1106319	hsa-miR-409-3p	CLIP-seq
MIRT1106320	hsa-miR-410	CLIP-seq
MIRT1106321	hsa-miR-4259	CLIP-seq
MIRT2029420	hsa-miR-4263	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT2029421	hsa-miR-4433	CLIP-seq
MIRT2029422	hsa-miR-4459	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106324	hsa-miR-4501	CLIP-seq
MIRT1106326	hsa-miR-4529-3p	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT1106329	hsa-miR-4668-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106331	hsa-miR-4709-3p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106333	hsa-miR-4715-5p	CLIP-seq
MIRT1106334	hsa-miR-4726-3p	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1550700	hsa-miR-4752	CLIP-seq
MIRT1106336	hsa-miR-4764-5p	CLIP-seq
MIRT2029423	hsa-miR-4768-3p	CLIP-seq
MIRT1106337	hsa-miR-4781-3p	CLIP-seq
MIRT1106338	hsa-miR-4789-5p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1550701	hsa-miR-520d-5p	CLIP-seq
MIRT1550702	hsa-miR-524-5p	CLIP-seq
MIRT2029424	hsa-miR-576-5p	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT2029418	hsa-miR-1252	CLIP-seq
MIRT1106286	hsa-miR-1261	CLIP-seq
MIRT1106288	hsa-miR-1269	CLIP-seq
MIRT1106289	hsa-miR-1269b	CLIP-seq
MIRT2260265	hsa-miR-1275	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106292	hsa-miR-141	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106294	hsa-miR-200a	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106304	hsa-miR-3148	CLIP-seq
MIRT1106306	hsa-miR-3153	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106314	hsa-miR-3614-5p	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106349	hsa-miR-3680	CLIP-seq
MIRT1550699	hsa-miR-3691-5p	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106317	hsa-miR-377	CLIP-seq
MIRT1106319	hsa-miR-409-3p	CLIP-seq
MIRT1106320	hsa-miR-410	CLIP-seq
MIRT1106321	hsa-miR-4259	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106326	hsa-miR-4529-3p	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT2260266	hsa-miR-4665-5p	CLIP-seq
MIRT1106329	hsa-miR-4668-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106331	hsa-miR-4709-3p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106333	hsa-miR-4715-5p	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1550700	hsa-miR-4752	CLIP-seq
MIRT1106337	hsa-miR-4781-3p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106344	hsa-miR-890	CLIP-seq
MIRT2260265	hsa-miR-1275	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106321	hsa-miR-4259	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT2260266	hsa-miR-4665-5p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106333	hsa-miR-4715-5p	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106352	hsa-miR-4719	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106357	hsa-miR-513b	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT2029418	hsa-miR-1252	CLIP-seq
MIRT1106288	hsa-miR-1269	CLIP-seq
MIRT1106289	hsa-miR-1269b	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106304	hsa-miR-3148	CLIP-seq
MIRT1106306	hsa-miR-3153	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106349	hsa-miR-3680	CLIP-seq
MIRT1550699	hsa-miR-3691-5p	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106317	hsa-miR-377	CLIP-seq
MIRT1106319	hsa-miR-409-3p	CLIP-seq
MIRT1106320	hsa-miR-410	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106326	hsa-miR-4529-3p	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT1106329	hsa-miR-4668-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106331	hsa-miR-4709-3p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106352	hsa-miR-4719	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1550700	hsa-miR-4752	CLIP-seq
MIRT1106337	hsa-miR-4781-3p	CLIP-seq
MIRT1106338	hsa-miR-4789-5p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106357	hsa-miR-513b	CLIP-seq
MIRT1550701	hsa-miR-520d-5p	CLIP-seq
MIRT1550702	hsa-miR-524-5p	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq
MIRT1106284	hsa-miR-105	CLIP-seq
MIRT2029418	hsa-miR-1252	CLIP-seq
MIRT1106288	hsa-miR-1269	CLIP-seq
MIRT1106289	hsa-miR-1269b	CLIP-seq
MIRT1106290	hsa-miR-1290	CLIP-seq
MIRT1106345	hsa-miR-149	CLIP-seq
MIRT1106346	hsa-miR-24	CLIP-seq
MIRT1106296	hsa-miR-30a	CLIP-seq
MIRT1106297	hsa-miR-30b	CLIP-seq
MIRT1106298	hsa-miR-30c	CLIP-seq
MIRT1106299	hsa-miR-30d	CLIP-seq
MIRT1106300	hsa-miR-30e	CLIP-seq
MIRT1106302	hsa-miR-3120-3p	CLIP-seq
MIRT1550698	hsa-miR-3121-5p	CLIP-seq
MIRT1106303	hsa-miR-3145-3p	CLIP-seq
MIRT1106304	hsa-miR-3148	CLIP-seq
MIRT1106306	hsa-miR-3153	CLIP-seq
MIRT1106347	hsa-miR-3156-5p	CLIP-seq
MIRT1106308	hsa-miR-3167	CLIP-seq
MIRT1106310	hsa-miR-338-3p	CLIP-seq
MIRT1106313	hsa-miR-34a	CLIP-seq
MIRT1106348	hsa-miR-3617	CLIP-seq
MIRT1106349	hsa-miR-3680	CLIP-seq
MIRT1550699	hsa-miR-3691-5p	CLIP-seq
MIRT1106316	hsa-miR-374c	CLIP-seq
MIRT1106317	hsa-miR-377	CLIP-seq
MIRT1106319	hsa-miR-409-3p	CLIP-seq
MIRT1106320	hsa-miR-410	CLIP-seq
MIRT2029420	hsa-miR-4263	CLIP-seq
MIRT1106322	hsa-miR-4310	CLIP-seq
MIRT1106323	hsa-miR-449b	CLIP-seq
MIRT1106326	hsa-miR-4529-3p	CLIP-seq
MIRT1106327	hsa-miR-4530	CLIP-seq
MIRT1106328	hsa-miR-4646-5p	CLIP-seq
MIRT1106329	hsa-miR-4668-5p	CLIP-seq
MIRT1106330	hsa-miR-4688	CLIP-seq
MIRT1106331	hsa-miR-4709-3p	CLIP-seq
MIRT1106332	hsa-miR-4711-5p	CLIP-seq
MIRT1106352	hsa-miR-4719	CLIP-seq
MIRT1106335	hsa-miR-4731-3p	CLIP-seq
MIRT1550700	hsa-miR-4752	CLIP-seq
MIRT1106337	hsa-miR-4781-3p	CLIP-seq
MIRT1106338	hsa-miR-4789-5p	CLIP-seq
MIRT1106339	hsa-miR-4801	CLIP-seq
MIRT1106353	hsa-miR-491-3p	CLIP-seq
MIRT1106354	hsa-miR-501-3p	CLIP-seq
MIRT1106355	hsa-miR-501-5p	CLIP-seq
MIRT1106356	hsa-miR-502-3p	CLIP-seq
MIRT1106357	hsa-miR-513b	CLIP-seq
MIRT1550701	hsa-miR-520d-5p	CLIP-seq
MIRT1550702	hsa-miR-524-5p	CLIP-seq
MIRT2029424	hsa-miR-576-5p	CLIP-seq
MIRT1106358	hsa-miR-641	CLIP-seq
MIRT1106341	hsa-miR-655	CLIP-seq
MIRT1106342	hsa-miR-675	CLIP-seq
MIRT1550703	hsa-miR-7	CLIP-seq
MIRT1106343	hsa-miR-876-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Unknown	9632793
HIF1A	Activation	8955077
HSF1	Activation	19668225
JUN	Activation	9723176
MYC	Activation	9723176
SP1	Activation	9723176

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004457	Function	Lactate dehydrogenase activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IBA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IMP	34381247
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	NAS	1953713
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	TAS	2334430
GO:0005515	Function	Protein binding	IPI	21988832, 23523103, 25416956, 25910212, 28514442, 31515488, 32296183, 33406399, 33961781, 34381247, 35271311
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	2434947
GO:0006089	Process	Lactate metabolic process	IBA
GO:0006089	Process	Lactate metabolic process	IDA	24816116, 34381247
GO:0006089	Process	Lactate metabolic process	ISS
GO:0006096	Process	Glycolytic process	NAS	1953713
GO:0016020	Component	Membrane	HDA	19946888
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0019661	Process	Glucose catabolic process to lactate via pyruvate	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0035686	Component	Sperm fibrous sheath	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 25502805, 31515488, 34381247
GO:0042867	Process	Pyruvate catabolic process	IBA
GO:0042867	Process	Pyruvate catabolic process	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 20458337, 23533145
GO:1990204	Component	Oxidoreductase complex	IPI	24816116
GO:1990204	Component	Oxidoreductase complex	ISS

Other IDs

• MIM: 150000
• HGNC: 6535
• e!Ensembl: ENSG00000134333

Protein

• UniProt ID: P00338
• Protein name: L-lactate dehydrogenase A chain (LDH-A) (EC 1.1.1.27) (Cell proliferation-inducing gene 19 protein) (LDH muscle subunit) (LDH-M) (Renal carcinoma antigen NY-REN-59)
• Protein function: Interconverts simultaneously and stereospecifically pyruvate and lactate with concomitant interconversion of NADH and NAD(+).
• PDB: 1I10, 4AJP, 4JNK, 4L4R, 4L4S, 4M49, 4OJN, 4OKN, 4QO7, 4QO8, 4QSM, 4QT0, 4R68, 4R69, 4RLS, 4ZVV, 5IXS, 5IXY, 5W8H, 5W8I, 5W8J, 5W8K, 5W8L, 5ZJD, 5ZJE, 5ZJF, 6BAD, 6BAG, 6BAX, 6BAZ, 6BB0, 6BB1, 6BB2, 6BB3, 6MV8, 6MVA, 6Q0D, 6Q13, 6SBU, 6SBV, 6ZZR, 7M2N, 8FW6, 9BK2, 9BK3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00056	Ldh_1_N	21 → 160	lactate/malate dehydrogenase, NAD binding domain	Family
  PF02866	Ldh_1_C	163 → 331	lactate/malate dehydrogenase, alpha/beta C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in anaerobic tissues such as skeletal muscle and liver. {ECO:0000305|PubMed:11276087}.
• Sequence:

  MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
  EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
  IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
  HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
  VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
  SDLVKVTLTSEEEARLKKSADTLWGIQKELQF

• Sequence length: 332

Pathways

KEGG:

Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
HIF-1 signaling pathway
Glucagon signaling pathway
Central carbon metabolism in cancer

Reactome:

Pyruvate metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency	Likely pathogenic; Pathogenic	rs2494611829, rs201372985, rs779023149, rs1590216677, rs1440890027, rs777988373	RCV003058293 RCV003062348 RCV002626065 RCV000015667 RCV003630842 RCV003629716	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
decreased blood alpha-hydroxyisovalerate levels	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI-BICKEL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOGEN STORAGE DISEASE XI	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LDHA-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	16132575		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29170050		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30158244		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29756998, 30509961		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26506419, 26956717, 28293396		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29601482, 30862721		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28818664		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	36292720	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34403518, 37973217	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	14578171	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34637921	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28818664		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29552147		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25983002		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28978061, 31814891		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	37973217	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	23333658		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	26269128		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32372141	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21452021, 23457597, 26902416, 27566995, 27598996, 28314283, 28461244, 28915924, 29725006, 30618169, 30684465, 30688660, 30878502, 31086462, 31570164		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20144215, 25575825, 28314283, 28729678, 30618169, 30878502, 31903982, 33353120, 33626175, 34625424, 36418319, 36737428	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23333658		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30248111		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26312753	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22961700, 25048361, 25838393, 37684649	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24714743		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26506419, 28325773, 30755064, 32084009, 32572027, 33289700, 33407546, 33771191, 33880589, 35286894, 36033372, 36157928, 37567069, 38025761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26733163, 28978061, 31814891		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25483567, 28446465, 28800787, 30026857		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24504108, 24885701, 35525866, 37547725, 37925501	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	8995558		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	15231041		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	37750583	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	15231041		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	8252591		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31814898		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31814898		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26506419, 26956717, 28293396		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29601482, 30862721		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24679073, 27615379		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24679073	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	24748236, 24789077		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24748236	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34975312	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18789002, 21660559, 22438825		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26062441, 28516914, 31375671		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33994363, 34110068, 34791830, 35832094, 36071678, 36923931, 37406987, 37626036, 38548218	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27615379, 31729681		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24885701, 25998032, 27027898, 28983605, 30189677		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30894817		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	36292720	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33276040	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33572095	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34217973	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37406987	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23121289, 26770982		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	30246236	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31119774		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31298316		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21305022, 31298316	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24796928, 34278456	Associate	★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	38111702	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27239113, 36555705	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22961700, 30861255, 35703190	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27222229, 31431459		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30744642		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29569755		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26509967		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	26509967	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24366912, 28756228		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26694942, 32611766, 40093910	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28756228, 29552147		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24223867, 27374173, 31187466, 31665443	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27374173, 29552147, 30745841, 31003211, 31187466		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27437179	Inhibit	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	GENOMICS_ENGLAND_DG	27604308, 6517049		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen storage disease	Pubtator	36292720	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease due to lactate dehydrogenase M-subunit deficiency	Glycogen Storage Disease	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Growth Disorders	Growth disorder	Pubtator	32877669	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24064966		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37750583	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32877669	Associate	★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	21409457	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	19276158		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	23228169	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	29704241		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31241439		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria Primary	Hyperoxaluria	Pubtator	37118061	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21409457, 21632858, 28193910, 30886157, 34278456, 36157928, 36656644	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21984181, 23419171, 24344305, 26059435, 29426376, 30165351, 31078780, 31554233, 32316196, 33300073, 34637697, 34853621, 35789607, 37067635, 37277450, 37522672, 37653539, 40093910, 40303408	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24275138	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29795645		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34711218, 36870568, 37653539	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31541143		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28495754		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34222486	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24679073		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	32877669	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34456629	Associate	★☆☆☆☆ Found in Text Mining only
Lactate dehydrogenase deficiency type A	Lactate Dehydrogenase B Deficiency	GENOMICS_ENGLAND_DG	1953713, 27604308, 6517049		★☆☆☆☆ Found in Text Mining only
Lactate dehydrogenase deficiency type A	Lactate Dehydrogenase B Deficiency	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Lactate dehydrogenase deficiency type A	Lactate Dehydrogenase B Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28269752	Associate	★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	29620641		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29620641	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25215489		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31298387	Associate	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	29620641		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22897481, 26506419, 26956717, 28293396, 29108994, 30503555, 31523182		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30744642	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18821170		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25838393, 37965333	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21319141, 33962616	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33677931	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	19021062		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	23583676		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27374173		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24064966		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21452021, 23457597, 26902416, 27566995, 27598996, 28314283, 28461244, 28915924, 29725006, 30618169, 30684465, 30688660, 30878502, 31086462, 31570164		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31298316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29569755		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23633457		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26506419, 26956717, 28293396, 31324019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25483567, 28800787, 30026857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29866066, 8995558		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23404405, 23523103, 24634381, 24947925, 26021472, 26113084, 31527446, 31689601		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	29384525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24714743, 25983002, 29891507, 31180564		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22429998, 24608789, 25394466, 26261559, 28874393, 30093943, 30165351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26733163, 28978061, 31814891		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14578171, 19088479, 19668225, 21452021, 21969607, 22897481, 23457597, 23523103, 23583676, 24366912, 24608789, 24634381, 24679073, 24885701, 26003569, 27261617, 27615379, 28218905, 28446465, 28756228, 28983605, 29199484, 29552193, 29866021, 29913092, 30069931, 30108883, 30158244, 30209241, 30403008, 31324019, 31523182, 31527446, 31813468		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31814898		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18789002		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	21452021		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23833310, 30248111		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29601482, 30862721		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25791837, 30209241, 30934955		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37684649	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	30894817		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	34278456	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31638999	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30248111		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23321518, 30051603		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23321518, 26545722	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31112527		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37852977	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	15231041		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	3279722		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	18534967		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	3383424		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24064966, 27458165		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28693517, 32679194, 33102573	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	28710417	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20133848, 20961996, 21452021, 21660559, 21969607, 22897481, 23139210, 23457597, 23817426, 23833310, 24064966, 24355259, 24885701, 24947925, 25791837, 25844669, 25880801, 25998032, 26021472, 26062441, 26269128, 26509967, 26658802, 26902416, 27374173, 27458165, 27591677, 27615379, 28043152, 28193910, 28293396, 28446465, 28461244, 28582845, 28680051, 28729678, 29552147, 29552193, 29569755, 29925504, 29932973, 30051603, 30158244, 30185973, 30189677, 30209241, 30213286, 30248111, 30356100, 30509961, 30618169, 30619178, 30745841, 30926903, 30934955, 31003211, 31035592, 31078152, 31297386, 31324019, 31527446, 31835667, 31838771		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20961996, 27919448, 29925504		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27919448	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28800787, 29321091, 30275702		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37973217	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27261617, 30088225, 30108883, 30213286		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8995558		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29866066, 34919531, 38583177	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	29704241		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23404405, 23523103, 24634381, 24947925, 26021472, 26113084, 31527446, 31689601		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24947925		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	29384525		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26021472, 26989901, 28193910, 29170050, 34632851, 34660806, 35789607, 36937004, 37277450, 37875474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37391503	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	BEFREE	12555229		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	LHGDN	12712614		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28680051		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	LHGDN	18821170		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	17178662		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24714743, 25983002, 29891507, 31180564		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24714743, 25983002, 29891507, 35242214, 35278714, 35571619	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36292720	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35145193	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28463588, 29795645		★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	27450766		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23633457		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27027898, 28983605, 30189677		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12406979		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16948864, 29620641	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29552193		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35090526	Inhibit	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency Autosomal Recessive T Cell Negative B Cell Positive NK Cell Positive	Severe combined immunodeficiency	Pubtator	36937004	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	1999544, 3789777		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22961700, 30861255		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25048361, 34463208, 34768921, 37194791, 37365531, 37762374	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29756998		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23920275, 28370718, 31100640		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22429998, 24608789, 25394466, 26261559, 28874393, 29577459, 30093943, 30165351		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20699381, 26261559, 30165351, 34455762	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	17178662		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25880801, 33677931, 33795650, 37031273, 37750019	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25880801		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25880801, 30768848, 33677931, 37864896	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	33677931	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27566995, 27598996, 28729678, 28915924, 29805099		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28729678, 32350346, 34440660	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	23333658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25266796, 26733163, 30864733, 34181805	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35615882	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	30356100		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33645623, 35615882, 36894874, 37326348	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35191522	Stimulate	★☆☆☆☆ Found in Text Mining only