LCN1 (lipocalin 1)

Gene

• Entrez ID: 3933
• Gene name: Lipocalin 1
• Gene symbol: LCN1
• Synonyms (NCBI Gene): PMFA, TLC, TP, VEGP
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overpro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018097	hsa-miR-335-5p	Microarray	18185580
MIRT1105783	hsa-miR-1193	CLIP-seq
MIRT1105784	hsa-miR-1287	CLIP-seq
MIRT1105785	hsa-miR-3135b	CLIP-seq
MIRT1105786	hsa-miR-3689d	CLIP-seq
MIRT2452880	hsa-miR-1587	CLIP-seq
MIRT2452881	hsa-miR-3150b-3p	CLIP-seq
MIRT2452882	hsa-miR-3189-3p	CLIP-seq
MIRT2452883	hsa-miR-4492	CLIP-seq
MIRT2452884	hsa-miR-4498	CLIP-seq
MIRT2452885	hsa-miR-4656	CLIP-seq
MIRT2452886	hsa-miR-4663	CLIP-seq
MIRT2452887	hsa-miR-4674	CLIP-seq
MIRT2452888	hsa-miR-4675	CLIP-seq
MIRT2452889	hsa-miR-4689	CLIP-seq
MIRT2452890	hsa-miR-4741	CLIP-seq
MIRT2452891	hsa-miR-4761-5p	CLIP-seq
MIRT2452892	hsa-miR-4784	CLIP-seq
MIRT2452893	hsa-miR-635	CLIP-seq
MIRT2452894	hsa-miR-762	CLIP-seq
MIRT2452881	hsa-miR-3150b-3p	CLIP-seq
MIRT2560425	hsa-miR-331-3p	CLIP-seq
MIRT2560426	hsa-miR-3657	CLIP-seq
MIRT2452886	hsa-miR-4663	CLIP-seq
MIRT2452889	hsa-miR-4689	CLIP-seq
MIRT2452891	hsa-miR-4761-5p	CLIP-seq
MIRT2452892	hsa-miR-4784	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	8999869
GO:0005102	Function	Signaling receptor binding	IPI	11287427
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8999869, 21805676
GO:0006508	Process	Proteolysis	TAS	8999869
GO:0008270	Function	Zinc ion binding	IDA	15489503
GO:0031404	Function	Chloride ion binding	IDA	15489503
GO:0036094	Function	Small molecule binding	IEA
GO:0050909	Process	Sensory perception of taste	IEA

Other IDs

• MIM: 151675
• HGNC: 6525
• e!Ensembl: ENSG00000160349

Protein

• UniProt ID: P31025
• Protein name: Lipocalin-1 (Tear lipocalin) (Tlc) (Tear prealbumin) (TP) (von Ebner gland protein) (VEG protein)
• Protein function: Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antib
• PDB: 1XKI, 3EYC, 4QAF, 5T43
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	32 → 169	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
• Sequence:

  MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLT
  TLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
  GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

• Sequence length: 176

Pathways

Reactome:

Transport of fatty acids

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	27327445	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	28778553		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26658059		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19118059, 31424267		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28886040		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	25748838		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26658059		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35935970	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10775053		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	9759656		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30606177		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28845433		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28845433		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27865104, 31848562		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	22736608	Inhibit	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	31010136	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36588538	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20190686		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	30961953	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30961953		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37108298	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28145562		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28145562		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20190686		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	21701529	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29896409, 31206501, 31242630		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	8831086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19118059, 31424267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26658059		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31424267		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28480981		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15037658, 26658059		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Associate	★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30145302		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29200724		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30145302		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24920892	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30947142		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10775053		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28778553		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31010136, 35740863	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	31740720		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35299682	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11473382		★☆☆☆☆ Found in Text Mining only