STMN1 (stathmin 1)

Gene

• Entrez ID: 3925
• Gene name: Stathmin 1
• Gene symbol: STMN1
• Synonyms (NCBI Gene): C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulatio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000129	hsa-miR-223-3p	-7	18555017
MIRT000129	hsa-miR-223-3p	-7	18555017
MIRT000129	hsa-miR-223-3p	-7	18555017
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21915098
MIRT000129	hsa-miR-223-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22470493
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay	23071542
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay	23071542
MIRT006149	hsa-miR-101-3p	Luciferase reporter assay	23071542
MIRT016339	hsa-miR-193b-3p	Microarray	20304954
MIRT021403	hsa-miR-9-5p	Reporter assay;Western blot;qRT-PCR	20362537
MIRT021744	hsa-miR-132-3p	Microarray	17612493
MIRT005166	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT042177	hsa-miR-484	CLASH	23622248
MIRT042177	hsa-miR-484	CLASH	23622248
MIRT037496	hsa-miR-744-5p	CLASH	23622248
MIRT054141	hsa-miR-210-3p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR	25187177
MIRT054141	hsa-miR-210-3p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR	25187177
MIRT000129	hsa-miR-223-3p	Luciferase assay, QRTPCR, Western blot	23584479
MIRT021403	hsa-miR-9-5p	Luciferase reporter assay	24043603
MIRT021403	hsa-miR-9-5p	Luciferase reporter assay	24043603
MIRT520907	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT520906	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT571609	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT505472	hsa-miR-425-5p	PAR-CLIP	20371350
MIRT505471	hsa-miR-3662	PAR-CLIP	20371350
MIRT505469	hsa-miR-4779	PAR-CLIP	20371350
MIRT505468	hsa-miR-5584-5p	PAR-CLIP	20371350
MIRT505467	hsa-miR-3163	PAR-CLIP	20371350
MIRT505466	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT505464	hsa-miR-4459	PAR-CLIP	20371350
MIRT505465	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT505463	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT505461	hsa-miR-3148	PAR-CLIP	20371350
MIRT505462	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT505459	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT505460	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT520907	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT520906	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT571609	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT520905	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT520900	hsa-miR-548ao-5p	PAR-CLIP	20371350
MIRT520899	hsa-miR-548ax	PAR-CLIP	20371350
MIRT520898	hsa-miR-5585-5p	PAR-CLIP	20371350
MIRT520907	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT520906	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT520905	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT520904	hsa-miR-4323	PAR-CLIP	23446348
MIRT520903	hsa-miR-3943	PAR-CLIP	23446348
MIRT520902	hsa-miR-6769a-3p	PAR-CLIP	23446348
MIRT520901	hsa-miR-6513-3p	PAR-CLIP	23446348
MIRT338798	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT338804	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT520900	hsa-miR-548ao-5p	PAR-CLIP	23446348
MIRT520899	hsa-miR-548ax	PAR-CLIP	23446348
MIRT520898	hsa-miR-5585-5p	PAR-CLIP	23446348
MIRT520897	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT520896	hsa-miR-6867-3p	PAR-CLIP	23446348
MIRT338797	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT520895	hsa-miR-30a-3p	PAR-CLIP	23446348
MIRT520894	hsa-miR-30d-3p	PAR-CLIP	23446348
MIRT520893	hsa-miR-30e-3p	PAR-CLIP	23446348
MIRT505472	hsa-miR-425-5p	PAR-CLIP	23446348
MIRT505471	hsa-miR-3662	PAR-CLIP	23446348
MIRT505470	hsa-miR-6757-3p	PAR-CLIP	23446348
MIRT505469	hsa-miR-4779	PAR-CLIP	23446348
MIRT505468	hsa-miR-5584-5p	PAR-CLIP	23446348
MIRT505467	hsa-miR-3163	PAR-CLIP	23446348
MIRT505466	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT505464	hsa-miR-4459	PAR-CLIP	23446348
MIRT505465	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT505463	hsa-miR-3117-5p	PAR-CLIP	23446348
MIRT505461	hsa-miR-3148	PAR-CLIP	23446348
MIRT505462	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT505459	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT505460	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT466901	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT466900	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT338782	hsa-miR-3609	PAR-CLIP	23592263
MIRT338783	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466895	hsa-miR-450b-3p	PAR-CLIP	23592263
MIRT466893	hsa-miR-769-3p	PAR-CLIP	23592263
MIRT466892	hsa-miR-6728-5p	PAR-CLIP	23592263
MIRT466890	hsa-miR-5089-5p	PAR-CLIP	23592263
MIRT466888	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT466901	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT466900	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT338782	hsa-miR-3609	PAR-CLIP	23592263
MIRT338783	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466898	hsa-miR-6074	PAR-CLIP	23592263
MIRT466899	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT466897	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT466896	hsa-miR-1302	PAR-CLIP	23592263
MIRT466894	hsa-miR-4298	PAR-CLIP	23592263
MIRT466895	hsa-miR-450b-3p	PAR-CLIP	23592263
MIRT466893	hsa-miR-769-3p	PAR-CLIP	23592263
MIRT466892	hsa-miR-6728-5p	PAR-CLIP	23592263
MIRT466890	hsa-miR-5089-5p	PAR-CLIP	23592263
MIRT466891	hsa-miR-3122	PAR-CLIP	23592263
MIRT466889	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT466888	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT520906	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	25928257
MIRT000129	hsa-miR-223-3p	qRT-PCR	25824152
MIRT733603	hsa-miR-143-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33991434
MIRT734644	hsa-miR-513a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31702387
MIRT016339	hsa-miR-193b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32855702
MIRT736579	hsa-miR-200a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33568625
MIRT733603	hsa-miR-143-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33991434
MIRT520907	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT520906	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT571609	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT505472	hsa-miR-425-5p	PAR-CLIP	20371350
MIRT505471	hsa-miR-3662	PAR-CLIP	20371350
MIRT505469	hsa-miR-4779	PAR-CLIP	20371350
MIRT505468	hsa-miR-5584-5p	PAR-CLIP	20371350
MIRT505467	hsa-miR-3163	PAR-CLIP	20371350
MIRT505466	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT505464	hsa-miR-4459	PAR-CLIP	20371350
MIRT505465	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT505463	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT505461	hsa-miR-3148	PAR-CLIP	20371350
MIRT505462	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT505459	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT505460	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT520907	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT520906	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT571609	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT520905	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT520900	hsa-miR-548ao-5p	PAR-CLIP	20371350
MIRT520899	hsa-miR-548ax	PAR-CLIP	20371350
MIRT520898	hsa-miR-5585-5p	PAR-CLIP	20371350
MIRT520907	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT520906	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT520905	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT520904	hsa-miR-4323	PAR-CLIP	23446348
MIRT520903	hsa-miR-3943	PAR-CLIP	23446348
MIRT520902	hsa-miR-6769a-3p	PAR-CLIP	23446348
MIRT520901	hsa-miR-6513-3p	PAR-CLIP	23446348
MIRT338798	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT338804	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT520900	hsa-miR-548ao-5p	PAR-CLIP	23446348
MIRT520899	hsa-miR-548ax	PAR-CLIP	23446348
MIRT520898	hsa-miR-5585-5p	PAR-CLIP	23446348
MIRT520897	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT520896	hsa-miR-6867-3p	PAR-CLIP	23446348
MIRT338797	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT520895	hsa-miR-30a-3p	PAR-CLIP	23446348
MIRT520894	hsa-miR-30d-3p	PAR-CLIP	23446348
MIRT520893	hsa-miR-30e-3p	PAR-CLIP	23446348
MIRT505472	hsa-miR-425-5p	PAR-CLIP	23446348
MIRT505471	hsa-miR-3662	PAR-CLIP	23446348
MIRT505470	hsa-miR-6757-3p	PAR-CLIP	23446348
MIRT505469	hsa-miR-4779	PAR-CLIP	23446348
MIRT505468	hsa-miR-5584-5p	PAR-CLIP	23446348
MIRT505467	hsa-miR-3163	PAR-CLIP	23446348
MIRT505466	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT505464	hsa-miR-4459	PAR-CLIP	23446348
MIRT505465	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT505463	hsa-miR-3117-5p	PAR-CLIP	23446348
MIRT505461	hsa-miR-3148	PAR-CLIP	23446348
MIRT505462	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT505459	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT505460	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT466901	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT466900	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT338782	hsa-miR-3609	PAR-CLIP	23592263
MIRT338783	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466895	hsa-miR-450b-3p	PAR-CLIP	23592263
MIRT466893	hsa-miR-769-3p	PAR-CLIP	23592263
MIRT466892	hsa-miR-6728-5p	PAR-CLIP	23592263
MIRT466890	hsa-miR-5089-5p	PAR-CLIP	23592263
MIRT466888	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT466901	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT466900	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT338782	hsa-miR-3609	PAR-CLIP	23592263
MIRT338783	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466898	hsa-miR-6074	PAR-CLIP	23592263
MIRT466899	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT466897	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT466896	hsa-miR-1302	PAR-CLIP	23592263
MIRT466894	hsa-miR-4298	PAR-CLIP	23592263
MIRT466895	hsa-miR-450b-3p	PAR-CLIP	23592263
MIRT466893	hsa-miR-769-3p	PAR-CLIP	23592263
MIRT466892	hsa-miR-6728-5p	PAR-CLIP	23592263
MIRT466890	hsa-miR-5089-5p	PAR-CLIP	23592263
MIRT466891	hsa-miR-3122	PAR-CLIP	23592263
MIRT466889	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT466888	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1398735	hsa-miR-1224-3p	CLIP-seq
MIRT1398736	hsa-miR-1224-5p	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1398738	hsa-miR-1277	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT1398741	hsa-miR-1299	CLIP-seq
MIRT1398742	hsa-miR-142-5p	CLIP-seq
MIRT1398743	hsa-miR-1587	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT1398747	hsa-miR-194	CLIP-seq
MIRT1398748	hsa-miR-221	CLIP-seq
MIRT1398749	hsa-miR-222	CLIP-seq
MIRT1398750	hsa-miR-2278	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1398753	hsa-miR-3120-3p	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT1398758	hsa-miR-3189-5p	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1398762	hsa-miR-3661	CLIP-seq
MIRT1398763	hsa-miR-378g	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT1398765	hsa-miR-425	CLIP-seq
MIRT1398766	hsa-miR-4291	CLIP-seq
MIRT1398767	hsa-miR-4307	CLIP-seq
MIRT1398768	hsa-miR-4310	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT1398770	hsa-miR-4433	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT1398775	hsa-miR-4490	CLIP-seq
MIRT1398776	hsa-miR-4492	CLIP-seq
MIRT1398777	hsa-miR-4498	CLIP-seq
MIRT1398778	hsa-miR-450b-5p	CLIP-seq
MIRT1398779	hsa-miR-4656	CLIP-seq
MIRT1398780	hsa-miR-4675	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398782	hsa-miR-4715-3p	CLIP-seq
MIRT1398783	hsa-miR-4719	CLIP-seq
MIRT1398784	hsa-miR-4732-5p	CLIP-seq
MIRT1398785	hsa-miR-4741	CLIP-seq
MIRT1398786	hsa-miR-4751	CLIP-seq
MIRT1398787	hsa-miR-4758-3p	CLIP-seq
MIRT1398788	hsa-miR-4766-5p	CLIP-seq
MIRT1398789	hsa-miR-4774-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398795	hsa-miR-513b	CLIP-seq
MIRT1398796	hsa-miR-518a-5p	CLIP-seq
MIRT1398797	hsa-miR-527	CLIP-seq
MIRT1398798	hsa-miR-548a-5p	CLIP-seq
MIRT1398799	hsa-miR-548ab	CLIP-seq
MIRT1398800	hsa-miR-548ah	CLIP-seq
MIRT1398801	hsa-miR-548ak	CLIP-seq
MIRT1398802	hsa-miR-548b-5p	CLIP-seq
MIRT1398803	hsa-miR-548c-5p	CLIP-seq
MIRT1398804	hsa-miR-548d-5p	CLIP-seq
MIRT1398805	hsa-miR-548h	CLIP-seq
MIRT1398806	hsa-miR-548i	CLIP-seq
MIRT1398807	hsa-miR-548j	CLIP-seq
MIRT1398808	hsa-miR-548t	CLIP-seq
MIRT1398809	hsa-miR-548v	CLIP-seq
MIRT1398810	hsa-miR-548w	CLIP-seq
MIRT1398811	hsa-miR-548y	CLIP-seq
MIRT1398812	hsa-miR-559	CLIP-seq
MIRT1398813	hsa-miR-561	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398817	hsa-miR-631	CLIP-seq
MIRT1398818	hsa-miR-634	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398820	hsa-miR-762	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398822	hsa-miR-802	CLIP-seq
MIRT1398823	hsa-miR-875-3p	CLIP-seq
MIRT1398824	hsa-miR-889	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq
MIRT1557154	hsa-miR-101	CLIP-seq
MIRT1557155	hsa-miR-1273d	CLIP-seq
MIRT1557156	hsa-miR-144	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1557157	hsa-miR-27a	CLIP-seq
MIRT1557158	hsa-miR-27b	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1557159	hsa-miR-323b-3p	CLIP-seq
MIRT1398767	hsa-miR-4307	CLIP-seq
MIRT1398770	hsa-miR-4433	CLIP-seq
MIRT1557160	hsa-miR-4661-5p	CLIP-seq
MIRT1398783	hsa-miR-4719	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398795	hsa-miR-513b	CLIP-seq
MIRT1557154	hsa-miR-101	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1557155	hsa-miR-1273d	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT1557156	hsa-miR-144	CLIP-seq
MIRT1398743	hsa-miR-1587	CLIP-seq
MIRT2119499	hsa-miR-1827	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT2119500	hsa-miR-223	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1557157	hsa-miR-27a	CLIP-seq
MIRT1557158	hsa-miR-27b	CLIP-seq
MIRT2119501	hsa-miR-3130-5p	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1557159	hsa-miR-323b-3p	CLIP-seq
MIRT2119502	hsa-miR-330-3p	CLIP-seq
MIRT1398763	hsa-miR-378g	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT1398765	hsa-miR-425	CLIP-seq
MIRT2119503	hsa-miR-4274	CLIP-seq
MIRT2119504	hsa-miR-4277	CLIP-seq
MIRT2119505	hsa-miR-4289	CLIP-seq
MIRT1398767	hsa-miR-4307	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT2119506	hsa-miR-4330	CLIP-seq
MIRT1398770	hsa-miR-4433	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT2119507	hsa-miR-4482	CLIP-seq
MIRT1398775	hsa-miR-4490	CLIP-seq
MIRT1398776	hsa-miR-4492	CLIP-seq
MIRT1398777	hsa-miR-4498	CLIP-seq
MIRT2119508	hsa-miR-4649-3p	CLIP-seq
MIRT1398779	hsa-miR-4656	CLIP-seq
MIRT1557160	hsa-miR-4661-5p	CLIP-seq
MIRT1398780	hsa-miR-4675	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398782	hsa-miR-4715-3p	CLIP-seq
MIRT1398783	hsa-miR-4719	CLIP-seq
MIRT1398785	hsa-miR-4741	CLIP-seq
MIRT1398789	hsa-miR-4774-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398795	hsa-miR-513b	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT2119509	hsa-miR-616	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398820	hsa-miR-762	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq
MIRT1557154	hsa-miR-101	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1557155	hsa-miR-1273d	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT1398741	hsa-miR-1299	CLIP-seq
MIRT2341719	hsa-miR-132	CLIP-seq
MIRT1557156	hsa-miR-144	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT2341720	hsa-miR-212	CLIP-seq
MIRT2119500	hsa-miR-223	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1557157	hsa-miR-27a	CLIP-seq
MIRT1557158	hsa-miR-27b	CLIP-seq
MIRT2119501	hsa-miR-3130-5p	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT2341721	hsa-miR-3184	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1557159	hsa-miR-323b-3p	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT2341722	hsa-miR-423-5p	CLIP-seq
MIRT1398765	hsa-miR-425	CLIP-seq
MIRT2119504	hsa-miR-4277	CLIP-seq
MIRT2341723	hsa-miR-4283	CLIP-seq
MIRT1398766	hsa-miR-4291	CLIP-seq
MIRT1398767	hsa-miR-4307	CLIP-seq
MIRT1398768	hsa-miR-4310	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT2119506	hsa-miR-4330	CLIP-seq
MIRT1398770	hsa-miR-4433	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT2119507	hsa-miR-4482	CLIP-seq
MIRT1398775	hsa-miR-4490	CLIP-seq
MIRT1557160	hsa-miR-4661-5p	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398782	hsa-miR-4715-3p	CLIP-seq
MIRT1398783	hsa-miR-4719	CLIP-seq
MIRT1398789	hsa-miR-4774-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398795	hsa-miR-513b	CLIP-seq
MIRT1398800	hsa-miR-548ah	CLIP-seq
MIRT1398808	hsa-miR-548t	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398818	hsa-miR-634	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT2341724	hsa-miR-665	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398823	hsa-miR-875-3p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq
MIRT1557154	hsa-miR-101	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1557155	hsa-miR-1273d	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT1557156	hsa-miR-144	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT2119500	hsa-miR-223	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1557157	hsa-miR-27a	CLIP-seq
MIRT1557158	hsa-miR-27b	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1557159	hsa-miR-323b-3p	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT1398765	hsa-miR-425	CLIP-seq
MIRT2119504	hsa-miR-4277	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT2119506	hsa-miR-4330	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT1557160	hsa-miR-4661-5p	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1398770	hsa-miR-4433	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398793	hsa-miR-4799-5p	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT2466194	hsa-miR-1271	CLIP-seq
MIRT2466195	hsa-miR-182	CLIP-seq
MIRT1398768	hsa-miR-4310	CLIP-seq
MIRT2466196	hsa-miR-885-3p	CLIP-seq
MIRT2466197	hsa-miR-96	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT2341719	hsa-miR-132	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT2341720	hsa-miR-212	CLIP-seq
MIRT2119500	hsa-miR-223	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1557157	hsa-miR-27a	CLIP-seq
MIRT1557158	hsa-miR-27b	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT2119504	hsa-miR-4277	CLIP-seq
MIRT1398766	hsa-miR-4291	CLIP-seq
MIRT1398767	hsa-miR-4307	CLIP-seq
MIRT1398768	hsa-miR-4310	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT2119506	hsa-miR-4330	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT1398775	hsa-miR-4490	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398782	hsa-miR-4715-3p	CLIP-seq
MIRT1398783	hsa-miR-4719	CLIP-seq
MIRT1398789	hsa-miR-4774-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398794	hsa-miR-5096	CLIP-seq
MIRT1398795	hsa-miR-513b	CLIP-seq
MIRT1398800	hsa-miR-548ah	CLIP-seq
MIRT1398808	hsa-miR-548t	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq
MIRT1398737	hsa-miR-1261	CLIP-seq
MIRT1398739	hsa-miR-1284	CLIP-seq
MIRT1398740	hsa-miR-1297	CLIP-seq
MIRT2341719	hsa-miR-132	CLIP-seq
MIRT1398744	hsa-miR-1910	CLIP-seq
MIRT1398745	hsa-miR-193a-3p	CLIP-seq
MIRT1398746	hsa-miR-193b	CLIP-seq
MIRT2341720	hsa-miR-212	CLIP-seq
MIRT2119500	hsa-miR-223	CLIP-seq
MIRT1398751	hsa-miR-26a	CLIP-seq
MIRT1398752	hsa-miR-26b	CLIP-seq
MIRT1398754	hsa-miR-3145-3p	CLIP-seq
MIRT1398755	hsa-miR-3150a-3p	CLIP-seq
MIRT1398756	hsa-miR-3175	CLIP-seq
MIRT1398757	hsa-miR-3179	CLIP-seq
MIRT1398759	hsa-miR-3201	CLIP-seq
MIRT1398760	hsa-miR-3202	CLIP-seq
MIRT1398761	hsa-miR-323-3p	CLIP-seq
MIRT1398764	hsa-miR-3944-5p	CLIP-seq
MIRT2119504	hsa-miR-4277	CLIP-seq
MIRT1398766	hsa-miR-4291	CLIP-seq
MIRT1398768	hsa-miR-4310	CLIP-seq
MIRT1398769	hsa-miR-4328	CLIP-seq
MIRT2119506	hsa-miR-4330	CLIP-seq
MIRT1398771	hsa-miR-4435	CLIP-seq
MIRT1398772	hsa-miR-4465	CLIP-seq
MIRT1398773	hsa-miR-4476	CLIP-seq
MIRT1398774	hsa-miR-4477a	CLIP-seq
MIRT1398775	hsa-miR-4490	CLIP-seq
MIRT1398781	hsa-miR-4712-5p	CLIP-seq
MIRT1398782	hsa-miR-4715-3p	CLIP-seq
MIRT1398789	hsa-miR-4774-5p	CLIP-seq
MIRT1398790	hsa-miR-4782-5p	CLIP-seq
MIRT1398791	hsa-miR-4786-3p	CLIP-seq
MIRT1398792	hsa-miR-4791	CLIP-seq
MIRT1398800	hsa-miR-548ah	CLIP-seq
MIRT1398808	hsa-miR-548t	CLIP-seq
MIRT1398814	hsa-miR-582-5p	CLIP-seq
MIRT1398815	hsa-miR-600	CLIP-seq
MIRT1398816	hsa-miR-622	CLIP-seq
MIRT1398819	hsa-miR-651	CLIP-seq
MIRT1398821	hsa-miR-770-5p	CLIP-seq
MIRT1398825	hsa-miR-9	CLIP-seq
MIRT1398826	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	23000483
EGR1	Unknown	19786090
JUN	Activation	15474303
KLF10	Repression	18930345
LYL1	Unknown	23000483

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0000281	Process	Mitotic cytokinesis	IMP	25122120
GO:0005515	Function	Protein binding	IPI	15652749, 21423803, 25416956
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007019	Process	Microtubule depolymerization	IBA
GO:0007019	Process	Microtubule depolymerization	IDA	9880330
GO:0007019	Process	Microtubule depolymerization	IMP	10675326
GO:0007052	Process	Mitotic spindle organization	IDA	9271428
GO:0007165	Process	Signal transduction	NAS	8003023
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0015631	Function	Tubulin binding	IBA
GO:0015631	Function	Tubulin binding	IDA	10675326
GO:0015631	Function	Tubulin binding	IMP	12860982
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IBA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IEA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IMP	12860982
GO:0031115	Process	Negative regulation of microtubule polymerization	IEA
GO:0031115	Process	Negative regulation of microtubule polymerization	IMP	25198505
GO:0031175	Process	Neuron projection development	IBA
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IMP	25198505
GO:0035556	Process	Intracellular signal transduction	TAS	2917975
GO:0043005	Component	Neuron projection	IBA
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IMP	25198505
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	25198505
GO:0061436	Process	Establishment of skin barrier	IMP	25198505
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IMP	25198505
GO:1905098	Process	Negative regulation of guanyl-nucleotide exchange factor activity	IMP	25198505

Other IDs

• MIM: 151442
• HGNC: 6510
• e!Ensembl: ENSG00000117632

Protein

• UniProt ID: P16949
• Protein name: Stathmin (Leukemia-associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)
• Protein function: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Invol
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00836	Stathmin	5 → 140	Stathmin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is read
• Sequence:

  MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
  RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
  ERLREKDKHIEEVRKNKESKDPADETEAD

• Sequence length: 149

Pathways

KEGG:

MAPK signaling pathway
MicroRNAs in cancer

Reactome:

Nuclear signaling by ERBB4

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	11922601		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1917919		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	2267130		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17001604		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12644570		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19258502, 22470493, 24433541, 28158640, 28457543, 29577639, 30910656		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	12242154, 24433541		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12644570, 27494889, 28158640, 28282798, 28457543		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	31441020		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	18461287, 19449284, 23106811, 9678541		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	29214451, 31441020		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26000982		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	15126347		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	29214451, 31441020		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19922137, 20840067, 21708901, 22274580, 22323753, 23022481, 23255347, 24210254, 24803543, 24809826, 25625564, 27466204, 28178525, 28459188, 28515487, 29313812, 29884807, 8651652		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	15509539		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	22187232, 24630593		★☆☆☆☆ Found in Text Mining only
Amyotrophy, monomelic	Monomelic Amyotrophy	BEFREE	15642858		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	17440165		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	18461287		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21242118	Stimulate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33247690	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25791566, 29374725		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	20946355		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23185405, 30978410		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23185405	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23185405, 30978410		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	29214451, 31441020		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	8677029, 8787675, 9748047		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	22197680		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28589243, 28594133		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31414226		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	28625575		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10638981, 10917544, 12460900, 16909102, 17452630, 20200495, 21045138, 22281755, 23071542, 23618950, 25072257, 25454514, 26334953, 27130664, 28766688, 29231257, 30478213, 9743287		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10638981, 10917544, 17452630, 18563556, 20816848, 22359235, 22480216, 23071542, 23925999, 25014225, 25072257, 26087399, 28766688, 32076022, 33201835, 34176226, 35504904, 40082837, 9743287	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17418982	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	19034510, 21683992	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	18461287, 26881937, 30478213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	26045786	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24885363, 36127700	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26505358, 27934948, 31783876, 31790363, 34556750, 35892599, 36304446, 37400785, 37773733, 39457014	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21683992	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	26206555, 26415052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25072257		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19786090, 23496232, 25384122, 28158640, 28282798, 28850563		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25791566	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34190011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24135250, 29577639	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14654788, 18054374, 23610071		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20657188, 30250588		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10393528, 19034510, 20657188, 30250588		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	9192274		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	15126347		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24708177, 28178656, 37789644	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28178656		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	16624860	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24903994	Associate	★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	28028751		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31611980		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	8514777	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20806969, 21612405, 21622897, 25063586, 29460479, 30966849		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19513025, 21622897, 23552806, 27249602, 31546234, 36221072, 40225568	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25063586	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	23552806	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	19625298		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28594133		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35152560	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24237934, 29187847		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21438138, 23185405, 23668904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	23185405, 31087825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23185405	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	23185405	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21873561		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771751		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21242118, 23538402, 23552806, 24587245, 26815505, 28532857, 30966849		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21242118, 21734474, 23552806, 28532857, 35533253	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26815505	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20819663		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	40037422	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	17549010		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24870766, 26782519		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23229199, 24870766, 26782519, 31983128, 33828156	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26782519		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23229199	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29577639	Stimulate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	14597228		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24708177		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	26466335		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	26466335		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27349455, 27577078, 28178656, 29312550		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	28178656	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22470493, 25075050		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	39215355	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17233837	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29880026		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29880026, 30082792		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	17440165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	22038457, 25348735, 28834690, 29667783, 31637705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	25348735, 29667783	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24355524		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	9743287	Associate	★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders, Nervous System	Heredodegenerative Disorders, Nervous System	BEFREE	18791638		★☆☆☆☆ Found in Text Mining only
HMN (Hereditary Motor Neuropathy) Proximal Type I	Hereditary Motor Neuropathy	BEFREE	10369885, 11734549, 12654964, 12875676, 29518354, 8677029, 8773609, 8922999, 9719377, 9748045, 9748047		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26000982		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25414277		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25414277		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31532353		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12242154		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	25266798		★☆☆☆☆ Found in Text Mining only
Juvenile Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	10655542, 24334346, 25716911, 8887955, 9153525		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25991737, 26045786	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25991737, 26045786, 36328498, 36344048	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	32425177	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10022911, 16624860, 20816848, 8514777	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18759697, 1917919, 20816848, 8464235		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1917919	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	31546234	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1917919, 8125092	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1930203, 29286103, 7925472	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	1930203	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29286103, 31612643		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16739096, 17596871, 17663418, 18555017, 19086098, 20204289, 20232364, 22911364, 24885363, 26505358, 27934948, 28982915, 31783876, 31785057		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24885363		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20232364, 28982915		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12644570		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12644570, 28282798, 34253824	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25105437	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	7772706		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19034510, 22470493, 23760979, 25791566, 27249602, 31983128, 36221072	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21242118, 24433541, 24870766, 26815505, 27878293, 29577639	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20816848, 8183936	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26000982, 8464235		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	34619856	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	23509938, 28594133, 28977875		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23185405		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	30377209		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17440165		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	17440165		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10638981, 10917544, 12460900, 16909102, 17452630, 20200495, 21045138, 23071542, 23618950, 25072257, 25454514, 26334953, 27130664, 28766688, 29231257, 30478213, 9743287		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21242118, 23538402, 23552806, 24587245, 28532857, 30966849		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26782519		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27577078		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31783876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18759697, 19786090, 23496232, 25384122, 28158640, 28282798, 28850563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14654788, 18054374, 23610071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24299310, 25215905, 29374725, 30198871		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16373697, 17172428, 17455228, 20816848, 22378487, 29025958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17455228		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22470493, 23760979, 24628949, 26802649, 28056823, 28334732, 30628664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25072257		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15474303, 16373697, 16495930, 16909102, 17172428, 17873971, 18054374, 18305103, 18461287, 18486187, 18759697, 19258502, 19449284, 19786090, 19800106, 20200495, 20204289, 21360534, 22470493, 22626996, 22665054, 23396365, 23496232, 23499911, 24306928, 24433541, 24686088, 25266798, 25285524, 25619726, 25791566, 27130664, 27579539, 27815492, 27878293, 27934948, 28158640, 28178656, 28334732, 28454324, 28589243, 28766688, 29147495, 29214451, 29545914, 30169496, 30250588, 30278466, 30628717, 30990738, 31611980, 31785057		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20657188, 30250588		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31611980		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	9743287		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	23509938		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15126347		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21612405, 22665054, 30422880		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34433638	Associate	★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31533641		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28625575, 28901666		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	21438138, 23185405, 23668904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	23185405, 31087825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	23583473		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17352214, 18759697		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	17352214	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17352214	Stimulate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	15474303		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26272359		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	17440165		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10655542, 11773003, 18093976, 28811488, 30842449, 31019235, 9147655		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10732802, 16049920, 17895963, 19884170, 20157854, 21325354, 21708901, 21840928, 23022481, 23063131, 23221635, 23615451, 25725227, 25735748, 28199839, 29790918, 29985170, 31363739, 31811660, 9073029, 9585359, 9748047		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Lower	Motor Neuron Disease	BEFREE	11993528, 12571787, 9585359		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	23509938		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20927383, 35297204	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28259901		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15659612		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19012073		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24355524		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	31546234		★☆☆☆☆ Found in Text Mining only
Myelopathic Muscular Atrophy	Myelopathic Muscular Atrophy	BEFREE	8786072		★☆☆☆☆ Found in Text Mining only
Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	12571787		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31068947, 9748045		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20110360, 20124091, 24218338, 25607713, 32767327, 33943007	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22417000, 24306928, 25607713, 27289016		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12242154, 12438255, 12644570, 16739096, 16909102, 17012855, 17352214, 17440165, 17663418, 18054374, 18305103, 18461287, 19034510, 19258502, 19800106, 20058236, 20232364, 20806969, 20816848, 21489836, 21944130, 22281755, 22470493, 23229199, 23396365, 23538402, 23618950, 23760979, 24043603, 24166148, 24299310, 24306928, 24433541, 24587245, 24720379, 24870766, 25075050, 25266798, 25285524, 25384122, 25903579, 26590596, 26802649, 26815505, 27289016, 27349455, 27494889, 27579539, 27878293, 27934948, 28216224, 28259950, 28350065, 28454324, 28589243, 28622584, 28625575, 29025958, 29039594, 29251330, 29374725, 29880026, 29948972, 30169496, 30278466, 30992462, 31078776, 9678541, 9743287		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1930203, 20816848, 23106811	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	2267130, 23106811, 23396365, 25692239, 27321182, 31806880		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10725331, 19351384, 20581815, 20705738, 21920940, 22763238, 23757500, 24332368, 24590288, 24769255, 26331341, 26464491, 27472505, 28069797, 28635376, 28852871, 29103974, 30012555, 31799625, 31851921		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17549010		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	3042790, 30910656		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	12441251, 16118268, 17103222, 18492800, 18755223, 20515750, 20826664, 20954180, 21118896, 21334976, 21693563, 22798624, 23727837, 25144193, 26311784, 27460344, 27483257, 27557711, 27699224, 28017471, 28178525, 28379354, 28642865, 28808928, 29069603, 29091570, 29982483, 30027400, 30102724, 31361024, 9837824		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	9192274		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19258502, 21453275, 24135250, 25384122, 25894372, 25921119, 26148901, 26220844, 26881937, 28259950, 28282798, 28457543, 28534969, 28589243, 28850563, 29113350, 29396238, 30628717, 30910656		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19513025	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	17440165		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	23298926		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	19221247	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17873971, 21612405, 24686088, 25310700, 28275089, 28529574, 28789348, 30169496, 30423576, 30992462		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30169496	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30423576	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14654788, 18054374		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23610071		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19322891, 20816848, 21683992, 25106448, 36328498, 39215355	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35186166	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24299310, 25215905, 29374725, 30198871		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25791566		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25266798, 30198871	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	25266798	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	18461287		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	21515208	Associate	★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	23552806	Associate	★☆☆☆☆ Found in Text Mining only
PARTINGTON X-LINKED MENTAL RETARDATION SYNDROME	Partington syndrome	BEFREE	23622180		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	18461287, 19449284, 23106811, 9678541		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	LHGDN	18461287		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	23106811	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	22083460		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23583473, 28491025		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	28387446		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	2267130		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	31653009		★☆☆☆☆ Found in Text Mining only
Progressive Muscular Atrophy	Progressive Muscular Atrophy	BEFREE	23477310		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15474303, 16373697, 17172428, 17455228, 22378487, 29025958		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17455228, 20058236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17455228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26124442, 36686485, 37165308	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35960497	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30183377		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	20085811, 22669476		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21546534, 26334953		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	23622180		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15652749, 18305103, 27579539		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25991737, 34982796	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	25991737	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29650266		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23396365		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30910656		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	10339583, 10369311, 10369862, 10369867, 10439956, 10496271, 10500148, 10508982, 10545039, 10556301, 10577272, 10601333, 10607836, 10655541, 10675659, 10732802, 10732817, 10773822, 10838245, 10931943, 11092763, 11121410, 11147573, 11181573, 11266116, 11274309, 11287750, 11303798, 11322942, 11354634, 11379882, 11438957, 11504946, 11562575, 11574669, 11641277, 11704667, 11907229, 11921836, 11978761, 12001651, 12210580, 12397076, 12436240, 12441251, 12614569, 12642665, 12760430, 12768044, 12815596, 12847076, 12875676, 12878704, 12879360, 12952942, 14520560, 14595654, 14597228, 14697339, 14715275, 15000810, 15162126, 15249625, 15523494, 15599397, 15790598, 15843395, 15862279, 15944201, 15964810, 15981080, 16000068, 16049920, 16093455, 16118268, 16204184, 16226920, 16301532, 16364894, 16449646, 16473550, 16481599, 16554261, 16607616, 16651888, 16936383, 16951947, 17178713, 17318264, 17585203, 17609673, 17627822, 17635841, 17640370, 17647030, 17717146, 17761651, 17761653, 17761654, 17761655, 17761657, 17895963, 17924536, 17932121, 17998247, 18093976, 18172693, 18178576, 18440926, 18455159, 18492800, 18508340, 18590823, 18601974, 18603534, 18629520, 18633133, 18649067, 18651653, 18662980, 18771690, 18791638, 18794368, 18941511, 19150990, 19198020, 19228773, 19286363, 19329542, 19351384, 19378506, 19430205, 19440247, 19535574, 19584083, 19584893, 19592581, 19603064, 19625298, 19758605, 19848583, 19860664, 19884170, 19897588, 20085811, 20157854, 20186123, 20194437, 20225030, 20392710, 20425235, 20442745, 20515750, 20564270, 20581815, 20605078, 20679391, 20705738, 20826664, 20840067, 20884664, 20954180, 21047176, 21082361, 21098506, 21118896, 21124729, 21174137, 21300694, 21325354, 21334976, 21339974, 21368223, 21482919, 21610752, 21672919, 21673580, 21693563, 21785213, 21785219, 21816274, 21826391, 21840928, 21920940, 21925145, 21971302, 21979052, 22134788, 22187232, 22197680, 22220673, 22302308, 22330725, 22362925, 22393244, 22422766, 22454072, 22558076, 22669476, 22701806, 22705478, 22750651, 22763238, 22798624, 23022481, 23029491, 23063130, 23063131, 23077215, 23112048, 23136128, 23157239, 23221635, 23255347, 23298926, 23315303, 23390132, 23467345, 23512182, 23615451, 23630626, 23656793, 23727836, 23727837, 23736298, 23740718, 23757500, 23863147, 23939659, 24067532, 24085424, 24124019, 24210254, 24317636, 24332368, 24391840, 24515897, 24590288, 24645792, 24722206, 24751385, 24769255, 24781211, 24803543, 24845847, 24923693, 24990202, 25068989, 25144193, 25483032, 25514431, 25516063, 25557785, 25561692, 25625564, 25692239, 25716911, 25727246, 25838041, 25911676, 25920617, 25986506, 26030728, 26063904, 26123042, 26134627, 26173388, 26189552, 26206889, 26214005, 26311784, 26331341, 26381381, 26419278, 26423457, 26464491, 26468953, 26758873, 26908606, 26931466, 27111068, 27241020, 27299419, 27299569, 27402754, 27460292, 27460344, 27466204, 27472505, 27483257, 27499521, 27510309, 27557711, 27621445, 27698380, 27699224, 27893852, 27894243, 27907033, 27939059, 28017471, 28069797, 28132687, 28139824, 28152480, 28161391, 28178525, 28193854, 28199839, 28250049, 28289706, 28379354, 28412171, 28426667, 28441483, 28450545, 28459188, 28481536, 28485722, 28515487, 28556834, 28570645, 28604635, 28623256, 28635376, 28637335, 28642865, 28648462, 28666123, 28728573, 28768735, 28799578, 28808928, 28811488, 28823932, 28826912, 28852871, 28899515, 28929094, 28945765, 28981879, 29061699, 29066780, 29069603, 29080838, 29091570, 29096367, 29103974, 29160009, 29187847, 29209912, 29220503, 29263925, 29281826, 29292768, 29294245, 29316633, 29378426, 29380287, 29391529, 29434670, 29473159, 29507115, 29518354, 29552580, 29580671, 29672276, 29703692, 29712837, 29790918, 29799103, 29884807, 29902268, 29941967, 29961886, 29982416, 29982483, 30008228, 30010942, 30012555, 30027400, 30065610, 30102724, 30171558, 30188931, 30233310, 30304024, 30327977, 30368521, 30408476, 30481286, 30553700, 30593463, 30649277, 30667343, 30733501, 30788592, 30805745, 30870495, 31019235, 31060774, 31102025, 31127156, 31156382, 31183542, 31230718, 31243392, 31270752, 31272106, 31301241, 31361024, 31363739, 31543414, 31563042, 31736847, 31797327, 31799625, 31803009, 31811660, 31828288, 31851921, 7581364, 7581461, 7813012, 8595417, 8677029, 8786072, 8787675, 8808598, 8875190, 8882869, 8887955, 8922999, 8929942, 8957014, 8968751, 9002676, 9067434, 9073029, 9147655, 9153454, 9153488, 9153525, 9185186, 9192274, 9207792, 9259265, 9295075, 9302277, 9341874, 9341891, 9345102, 9389483, 9443903, 9590291, 9667776, 9668169, 9719377, 9731538, 9783849, 9801871, 9818944, 9837824, 9845364		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16495930, 19258502, 26590596, 28806997, 29577639		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16495930		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21360534, 23229199, 23975322, 24372619, 25572118, 25944168, 28350065, 28603065, 28977901, 29251330, 29577639, 30616477		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16495930, 33247690	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27878293	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24135250, 28933054		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29847156		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	27878293		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22470493, 23760979, 24628949, 26802649, 28056823, 28334732, 30628664		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22470493, 23760979, 24628949, 28056823, 28334732	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	22626996		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	23185405, 24885363	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	40493560	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29323124		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35504904, 36484700	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31611980		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25072257, 25928257, 26081836, 32614890	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40367012	Stimulate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19800106, 22626996		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19034510	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25415225	Associate	★☆☆☆☆ Found in Text Mining only