Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	391712
Gene name	Tripartite motif containing 61
Gene symbol	TRIM61
Synonyms (NCBI Gene)	RNF35
Chromosome	4
Chromosome location	4q32.3

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments
MIRT1455491	hsa-miR-103a	CLIP-seq
MIRT1455492	hsa-miR-107	CLIP-seq
MIRT1455493	hsa-miR-1285	CLIP-seq
MIRT1455494	hsa-miR-3122	CLIP-seq
MIRT1455495	hsa-miR-3180-5p	CLIP-seq
MIRT1455496	hsa-miR-3187-5p	CLIP-seq
MIRT1455497	hsa-miR-3913-5p	CLIP-seq
MIRT1455498	hsa-miR-4433	CLIP-seq
MIRT1455499	hsa-miR-4459	CLIP-seq
MIRT1455500	hsa-miR-4768-3p	CLIP-seq
MIRT1455501	hsa-miR-520a-5p	CLIP-seq
MIRT1455502	hsa-miR-525-5p	CLIP-seq
MIRT1455503	hsa-miR-612	CLIP-seq
MIRT1455504	hsa-miR-661	CLIP-seq
MIRT1455493	hsa-miR-1285	CLIP-seq
MIRT1455495	hsa-miR-3180-5p	CLIP-seq
MIRT1455496	hsa-miR-3187-5p	CLIP-seq
MIRT2136539	hsa-miR-3714	CLIP-seq
MIRT2136540	hsa-miR-3922-5p	CLIP-seq
MIRT1455498	hsa-miR-4433	CLIP-seq
MIRT1455499	hsa-miR-4459	CLIP-seq
MIRT1455500	hsa-miR-4768-3p	CLIP-seq
MIRT1455501	hsa-miR-520a-5p	CLIP-seq
MIRT1455502	hsa-miR-525-5p	CLIP-seq
MIRT1455503	hsa-miR-612	CLIP-seq
MIRT1455504	hsa-miR-661	CLIP-seq
MIRT2136541	hsa-miR-940	CLIP-seq
MIRT1455494	hsa-miR-3122	CLIP-seq
MIRT2651085	hsa-miR-3689a-3p	CLIP-seq
MIRT2651086	hsa-miR-3689c	CLIP-seq
MIRT1455497	hsa-miR-3913-5p	CLIP-seq
MIRT2136540	hsa-miR-3922-5p	CLIP-seq
MIRT2651087	hsa-miR-4728-5p	CLIP-seq
MIRT1455494	hsa-miR-3122	CLIP-seq
MIRT2651085	hsa-miR-3689a-3p	CLIP-seq
MIRT2651086	hsa-miR-3689c	CLIP-seq
MIRT1455497	hsa-miR-3913-5p	CLIP-seq
MIRT2136540	hsa-miR-3922-5p	CLIP-seq
MIRT2651087	hsa-miR-4728-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA

MIM	HGNC	e!Ensembl
619417	24339	ENSG00000183439

Q5EBN2

Protein name

Putative tripartite motif-containing protein 61 (RING finger protein 35)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	92 → 133	B-box zinc finger	Domain

Sequence

MEFVTALADLRAEASCPICLDYLKDPVTISCGHNFCLSCIIMSWKDLHDSFPCPFCHFCC
PERKFISNPQLGSLTEIAKQLQIRSKKRKRQEEKHVCKKHNQVLTFFCQKDLELLCPRCS
LSTDHQHHCVWPIKKAASYHRKKLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPS
VTRLECSCTISAHFNLRLPGSSDSSASGS

Sequence length

209

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TRIM61 (tripartite motif containing 61)