Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3916
Gene name	Lysosomal associated membrane protein 1
Gene symbol	LAMP1
Synonyms (NCBI Gene)	CD107aLAMPALGP120
Chromosome	13
Chromosome location	13q34
Summary	The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]

140

Show/Hide all (140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019659	hsa-miR-378a-3p	Sequencing	20371350
MIRT023236	hsa-miR-122-5p	Microarray	17612493
MIRT019659	hsa-miR-378a-3p	CLASH	23622248
MIRT041727	hsa-miR-484	CLASH	23622248
MIRT039887	hsa-miR-615-3p	CLASH	23622248
MIRT036408	hsa-miR-1227-3p	CLASH	23622248
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assayqRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assayqRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assayqRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assayqRT-PCR	25030422
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT1103485	hsa-miR-3177-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT1103492	hsa-miR-3919	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103494	hsa-miR-4281	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103496	hsa-miR-4433	CLIP-seq
MIRT1103497	hsa-miR-4459	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT1103500	hsa-miR-4640-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT1103503	hsa-miR-4756-3p	CLIP-seq
MIRT1103504	hsa-miR-4768-3p	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT2028269	hsa-miR-1265	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2028270	hsa-miR-2054	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT2028271	hsa-miR-2392	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2028272	hsa-miR-3183	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT2028274	hsa-miR-3613-5p	CLIP-seq
MIRT2028275	hsa-miR-4326	CLIP-seq
MIRT2028276	hsa-miR-452	CLIP-seq
MIRT2028277	hsa-miR-4653-3p	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2028279	hsa-miR-4676-3p	CLIP-seq
MIRT2028280	hsa-miR-4684-5p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2028281	hsa-miR-4723-3p	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2028284	hsa-miR-550a	CLIP-seq
MIRT2028285	hsa-miR-580	CLIP-seq
MIRT2028286	hsa-miR-642a	CLIP-seq
MIRT2028287	hsa-miR-651	CLIP-seq
MIRT2259421	hsa-miR-106a	CLIP-seq
MIRT2259422	hsa-miR-106b	CLIP-seq
MIRT2259423	hsa-miR-1202	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT2259424	hsa-miR-129-3p	CLIP-seq
MIRT2259425	hsa-miR-1303	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2259426	hsa-miR-17	CLIP-seq
MIRT2259427	hsa-miR-20a	CLIP-seq
MIRT2259428	hsa-miR-20b	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2259429	hsa-miR-3130-5p	CLIP-seq
MIRT2259430	hsa-miR-3158-5p	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT2259431	hsa-miR-3166	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT2259433	hsa-miR-342-3p	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT2259434	hsa-miR-3972	CLIP-seq
MIRT2259435	hsa-miR-421	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT2259436	hsa-miR-4482	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2259437	hsa-miR-4695-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2259438	hsa-miR-4709-5p	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT2259439	hsa-miR-4766-3p	CLIP-seq
MIRT2259440	hsa-miR-4771	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2259441	hsa-miR-4780	CLIP-seq
MIRT2259442	hsa-miR-4802-5p	CLIP-seq
MIRT2259443	hsa-miR-505	CLIP-seq
MIRT2259444	hsa-miR-518e	CLIP-seq
MIRT2259445	hsa-miR-519d	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2259446	hsa-miR-548p	CLIP-seq
MIRT2259447	hsa-miR-548t	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT2259448	hsa-miR-93	CLIP-seq
MIRT2438312	hsa-miR-1247	CLIP-seq
MIRT2438313	hsa-miR-1538	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2438314	hsa-miR-4691-3p	CLIP-seq
MIRT2438315	hsa-miR-4745-3p	CLIP-seq
MIRT2438316	hsa-miR-644	CLIP-seq
MIRT2438317	hsa-miR-663b	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	21194361, 23394946, 24970085, 32296183, 37390818
GO:0005737	Component	Cytoplasm	IDA	21266579
GO:0005764	Component	Lysosome	IDA	15613468
GO:0005764	Component	Lysosome	IDA	15052268, 15292400, 16542649, 22792322, 23704327
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	TAS	3131762
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	16176980
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IDA	15052268, 15292400, 15792797, 16542649, 18388320, 18767904
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20956541
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3174652
GO:0007042	Process	Lysosomal lumen acidification	IDA	37390818
GO:0007042	Process	Lysosomal lumen acidification	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008200	Function	Ion channel inhibitor activity	IDA	37390818
GO:0008200	Function	Ion channel inhibitor activity	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3174652
GO:0019899	Function	Enzyme binding	IPI	22641697
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IEA
GO:0031982	Component	Vesicle	IEA
GO:0035577	Component	Azurophil granule membrane	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035752	Process	Lysosomal lumen pH elevation	IDA	35750034
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IMP	23632890
GO:0044194	Component	Cytolytic granule	IEA
GO:0044754	Component	Autolysosome	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	23632890
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	18787122
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0061474	Component	Phagolysosome membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072594	Process	Establishment of protein localization to organelle	IBA
GO:0072594	Process	Establishment of protein localization to organelle	IMP	23632890
GO:0090160	Process	Golgi to lysosome transport	IMP	23632890
GO:0101003	Component	Ficolin-1-rich granule membrane	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0101004	Component	Cytolytic granule membrane	IDA	24088571
GO:0101004	Component	Cytolytic granule membrane	IEA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IMP	23632890
GO:1902513	Process	Regulation of organelle transport along microtubule	IMP	23632890
GO:1902600	Process	Proton transmembrane transport	IDA	35750034

MIM	HGNC	e!Ensembl
153330	6499	ENSG00000185896

P11279

Protein name

Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)

Protein function

Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation, autophagy and cholesterol homeostasis (PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as

PDB

8ATH , 8FY5 , 8FYF , 9C59 , 9C5A , 9C5B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01299	Lamp	217 → 365	Lysosome-associated membrane glycoprotein (Lamp)	Family

Sequence

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Virion - Lassa virus and SFTS virus Autophagy - animal Lysosome Phagosome Tuberculosis		Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (136)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	19965687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27834032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31784980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30082222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25251993, 28055007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26627638, 28984607, 37418137	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	26936765	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	29695488		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31288830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	25633562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18607068, 28687162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23826410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25492700, 27765614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28170096, 30319620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28170096, 30319620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25546329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29085473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19522481, 27560716, 34543006, 7511141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11815981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38218945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23172893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29444517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23172893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	37122702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23286717	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30018669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	26478006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36059513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	30087584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28320834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18683215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28968876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27834032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11485903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30988067	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31425520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	25031264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	26936765	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	27061067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11485903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	38302650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26936765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27773683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29236750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29236750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28573460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30082222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	33218198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	35675510	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	24334114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	28275109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	39394558	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30142454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24415789		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29563863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	24619111, 29790198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29790198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	11825063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26863628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30909789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30909789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31649684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	27780934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	32051464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32849519	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32358389	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31650902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32255193, 33123602	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29274721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29881390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30087584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34482820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	22803570, 29748975		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15744340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27907031, 36960055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35121522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	32161179	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	26627638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22028659, 31049024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	16778144, 24916509, 27413758, 28270454, 32375849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	16778144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28270454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15744340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25251993	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29920782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25546329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29085473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31288830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27212625, 31544977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18706445, 27834032, 29085473, 31377388		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16718270		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21829468, 30524902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30728070, 36087066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28887642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29089645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29500635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23656307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	25702170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	39346912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30604316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22310933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30282967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15386741, 18957055, 20428766, 21829468, 24438073, 2676155, 28239463, 28537894, 28687162, 28875329, 29512369, 29791021, 30778749, 31164357, 31522446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	24924335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29367433, 30282967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19948031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30323741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23172893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31288830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11815981, 27109098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	31101076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27061067, 30055128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30055128, 30945962, 30983487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30922709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	22098537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27212625, 31544977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27212625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31067781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31067781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33174446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30975014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23799359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	23372690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	29980238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28687162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19319529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30142454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29273596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	27061067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tay-Sachs Disease	Tay-Sachs Disease	BEFREE	31283907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	29985398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	38436206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31215164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Vacuolar myopathy	Pubtator	35740979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LAMP1 (lysosomal associated membrane protein 1)