PABPN1L (PABPN1 like, cytoplasmic)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 390748
Gene name PABPN1 like, cytoplasmic
Gene symbol PABPN1L
Synonyms (NCBI Gene)
PABPNL1ePABP2
Chromosome 16
Chromosome location 16q24.3
miRNA miRNA information provided by mirtarbase database.
37
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (37)
miRTarBase ID miRNA Experiments Reference
MIRT527028 hsa-miR-4323 PAR-CLIP 22012620
MIRT527027 hsa-miR-2392 PAR-CLIP 22012620
MIRT527026 hsa-miR-6840-3p PAR-CLIP 22012620
MIRT527025 hsa-miR-6752-3p PAR-CLIP 22012620
MIRT527024 hsa-miR-7113-3p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IBA
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NDY0
Protein name Embryonic polyadenylate-binding protein 2 (Embryonic poly(A)-binding protein 2) (ePABP-2) (ePABP2) (Embryonic poly(A)-binding protein type II) (Poly(A)-binding protein nuclear-like 1)
Protein function Binds the poly(A) tail of mRNA.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 149 → 218 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in various adult tissues. {ECO:0000269|PubMed:18483763}.
Sequence 
MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEED
QDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTA
AGQLLSPETVGCPLSGTPEEKVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILC
DKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPGISSTDRGGLRGH
PGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY
Sequence length 278
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  mRNA surveillance pathway
Influenza A 		 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations