Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	390664
Gene name	C1q and TNF related 8
Gene symbol	C1QTNF8
Synonyms (NCBI Gene)	CTRP8UNQ5829
Chromosome	16
Chromosome location	16p13.3

Show/Hide all (70)

miRTarBase ID	miRNA	Experiments
MIRT842471	hsa-miR-1224-3p	CLIP-seq
MIRT842472	hsa-miR-1231	CLIP-seq
MIRT842473	hsa-miR-1260	CLIP-seq
MIRT842474	hsa-miR-1260b	CLIP-seq
MIRT842475	hsa-miR-1280	CLIP-seq
MIRT842476	hsa-miR-3192	CLIP-seq
MIRT842477	hsa-miR-323b-5p	CLIP-seq
MIRT842478	hsa-miR-3669	CLIP-seq
MIRT842479	hsa-miR-4288	CLIP-seq
MIRT842480	hsa-miR-4293	CLIP-seq
MIRT842481	hsa-miR-4314	CLIP-seq
MIRT842482	hsa-miR-4320	CLIP-seq
MIRT842483	hsa-miR-4646-5p	CLIP-seq
MIRT842484	hsa-miR-4649-3p	CLIP-seq
MIRT842485	hsa-miR-4655-3p	CLIP-seq
MIRT842486	hsa-miR-4667-5p	CLIP-seq
MIRT842487	hsa-miR-4700-5p	CLIP-seq
MIRT842488	hsa-miR-532-3p	CLIP-seq
MIRT842489	hsa-miR-544b	CLIP-seq
MIRT842490	hsa-miR-572	CLIP-seq
MIRT842491	hsa-miR-632	CLIP-seq
MIRT842492	hsa-miR-637	CLIP-seq
MIRT842493	hsa-miR-885-3p	CLIP-seq
MIRT1949638	hsa-miR-1184	CLIP-seq
MIRT1949639	hsa-miR-1207-5p	CLIP-seq
MIRT1949640	hsa-miR-150	CLIP-seq
MIRT1949641	hsa-miR-370	CLIP-seq
MIRT1949642	hsa-miR-4436a	CLIP-seq
MIRT1949643	hsa-miR-4436b-3p	CLIP-seq
MIRT1949644	hsa-miR-4685-5p	CLIP-seq
MIRT1949645	hsa-miR-4713-5p	CLIP-seq
MIRT1949646	hsa-miR-4763-3p	CLIP-seq
MIRT842488	hsa-miR-532-3p	CLIP-seq
MIRT1949647	hsa-miR-767-5p	CLIP-seq
MIRT842471	hsa-miR-1224-3p	CLIP-seq
MIRT2187681	hsa-miR-1254	CLIP-seq
MIRT2187682	hsa-miR-2115	CLIP-seq
MIRT2187683	hsa-miR-3116	CLIP-seq
MIRT2187684	hsa-miR-3119	CLIP-seq
MIRT2187685	hsa-miR-3123	CLIP-seq
MIRT2187686	hsa-miR-342-5p	CLIP-seq
MIRT2187687	hsa-miR-34c-3p	CLIP-seq
MIRT2187688	hsa-miR-3614-5p	CLIP-seq
MIRT2187689	hsa-miR-3919	CLIP-seq
MIRT2187690	hsa-miR-4514	CLIP-seq
MIRT842484	hsa-miR-4649-3p	CLIP-seq
MIRT2187691	hsa-miR-4651	CLIP-seq
MIRT2187692	hsa-miR-4664-5p	CLIP-seq
MIRT2187693	hsa-miR-4667-3p	CLIP-seq
MIRT842486	hsa-miR-4667-5p	CLIP-seq
MIRT2187694	hsa-miR-4692	CLIP-seq
MIRT842487	hsa-miR-4700-5p	CLIP-seq
MIRT2187695	hsa-miR-4749-3p	CLIP-seq
MIRT2187696	hsa-miR-4795-5p	CLIP-seq
MIRT2187697	hsa-miR-608	CLIP-seq
MIRT2187698	hsa-miR-661	CLIP-seq
MIRT842471	hsa-miR-1224-3p	CLIP-seq
MIRT842473	hsa-miR-1260	CLIP-seq
MIRT842474	hsa-miR-1260b	CLIP-seq
MIRT842475	hsa-miR-1280	CLIP-seq
MIRT2385130	hsa-miR-326	CLIP-seq
MIRT2385131	hsa-miR-330-5p	CLIP-seq
MIRT842486	hsa-miR-4667-5p	CLIP-seq
MIRT842487	hsa-miR-4700-5p	CLIP-seq
MIRT842488	hsa-miR-532-3p	CLIP-seq
MIRT842493	hsa-miR-885-3p	CLIP-seq
MIRT2491618	hsa-miR-4265	CLIP-seq
MIRT2491619	hsa-miR-4296	CLIP-seq
MIRT2491620	hsa-miR-4322	CLIP-seq
MIRT2491621	hsa-miR-4417	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19666007, 24014093
GO:0005576	Component	Extracellular region	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:2000147	Process	Positive regulation of cell motility	IDA	24014093

MIM	HGNC	e!Ensembl
614147	31374	ENSG00000184471

P60827

Protein name

Complement C1q tumor necrosis factor-related protein 8 (C1q/TNF-related protein 8) (CTRP8)

Protein function

May play a role as ligand of RXFP1.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	68 → 116	Collagen triple helix repeat (20 copies)	Repeat
PF00386	C1q	118 → 246	C1q domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in lung and testis (PubMed:19666007). Expressed in astrocytes (PubMed:24014093). {ECO:0000269|PubMed:19666007, ECO:0000269|PubMed:24014093}.

Sequence

MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVR
PTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFS
VGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYL
HIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYIT
FSGHLVKPAAEL

Sequence length

252

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Brain Neoplasms	Brain Neoplasms	BEFREE	29949238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29949238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39542181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25915599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29949238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29949238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29949238		★★★★★ ★☆☆☆☆ Found in Text Mining only

C1QTNF8 (C1q and TNF related 8)