Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3903
Gene name	Leukocyte associated immunoglobulin like receptor 1
Gene symbol	LAIR1
Synonyms (NCBI Gene)	CD305LAIR-1
Chromosome	19
Chromosome location	19q13.42
Summary	The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gen

260

Show/Hide all (260)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037585	hsa-miR-744-5p	CLASH	23622248
MIRT713284	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT713283	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT713282	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT713281	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT676690	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT676689	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT713280	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT713279	hsa-miR-7973	HITS-CLIP	19536157
MIRT713278	hsa-miR-197-3p	HITS-CLIP	19536157
MIRT713277	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT713276	hsa-miR-4436b-5p	HITS-CLIP	19536157
MIRT713275	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT713274	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT676695	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT676694	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT676693	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT676692	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT676691	hsa-miR-1976	HITS-CLIP	23824327
MIRT676690	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT676689	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT676688	hsa-miR-4454	HITS-CLIP	23824327
MIRT676687	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676686	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT713284	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT713283	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT713282	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT713281	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT676690	hsa-miR-6790-3p	HITS-CLIP	19536157
MIRT676689	hsa-miR-6821-3p	HITS-CLIP	19536157
MIRT713280	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT713279	hsa-miR-7973	HITS-CLIP	19536157
MIRT713278	hsa-miR-197-3p	HITS-CLIP	19536157
MIRT713277	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT713276	hsa-miR-4436b-5p	HITS-CLIP	19536157
MIRT713275	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT713274	hsa-miR-3692-3p	HITS-CLIP	19536157
MIRT676695	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT676694	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT676693	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT676692	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT676691	hsa-miR-1976	HITS-CLIP	23824327
MIRT676690	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT676689	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT676688	hsa-miR-4454	HITS-CLIP	23824327
MIRT676687	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676686	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1103171	hsa-miR-23a	CLIP-seq
MIRT1103172	hsa-miR-23b	CLIP-seq
MIRT1103173	hsa-miR-23c	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103180	hsa-miR-106a	CLIP-seq
MIRT1103181	hsa-miR-106b	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1103182	hsa-miR-1234	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1103184	hsa-miR-150	CLIP-seq
MIRT1103185	hsa-miR-17	CLIP-seq
MIRT1103186	hsa-miR-20a	CLIP-seq
MIRT1103187	hsa-miR-20b	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1103188	hsa-miR-302a	CLIP-seq
MIRT1103189	hsa-miR-302b	CLIP-seq
MIRT1103190	hsa-miR-302c	CLIP-seq
MIRT1103191	hsa-miR-302d	CLIP-seq
MIRT1103192	hsa-miR-302e	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1103193	hsa-miR-3614-3p	CLIP-seq
MIRT1103194	hsa-miR-372	CLIP-seq
MIRT1103195	hsa-miR-373	CLIP-seq
MIRT1103196	hsa-miR-4294	CLIP-seq
MIRT1103197	hsa-miR-4297	CLIP-seq
MIRT1103198	hsa-miR-4438	CLIP-seq
MIRT1103199	hsa-miR-4446-5p	CLIP-seq
MIRT1103200	hsa-miR-4650-5p	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103201	hsa-miR-4731-5p	CLIP-seq
MIRT1103202	hsa-miR-4755-5p	CLIP-seq
MIRT1103203	hsa-miR-501-3p	CLIP-seq
MIRT1103204	hsa-miR-502-3p	CLIP-seq
MIRT1103205	hsa-miR-5095	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103206	hsa-miR-512-3p	CLIP-seq
MIRT1103207	hsa-miR-519d	CLIP-seq
MIRT1103208	hsa-miR-520a-3p	CLIP-seq
MIRT1103209	hsa-miR-520b	CLIP-seq
MIRT1103210	hsa-miR-520c-3p	CLIP-seq
MIRT1103211	hsa-miR-520d-3p	CLIP-seq
MIRT1103212	hsa-miR-520e	CLIP-seq
MIRT1103213	hsa-miR-520g	CLIP-seq
MIRT1103214	hsa-miR-520h	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103215	hsa-miR-642a	CLIP-seq
MIRT1103216	hsa-miR-671-5p	CLIP-seq
MIRT1103217	hsa-miR-769-5p	CLIP-seq
MIRT1103218	hsa-miR-93	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT1103180	hsa-miR-106a	CLIP-seq
MIRT1103181	hsa-miR-106b	CLIP-seq
MIRT1103169	hsa-miR-1193	CLIP-seq
MIRT2028213	hsa-miR-1281	CLIP-seq
MIRT1103184	hsa-miR-150	CLIP-seq
MIRT1103185	hsa-miR-17	CLIP-seq
MIRT1103186	hsa-miR-20a	CLIP-seq
MIRT1103187	hsa-miR-20b	CLIP-seq
MIRT1103170	hsa-miR-2392	CLIP-seq
MIRT1103174	hsa-miR-3152-3p	CLIP-seq
MIRT2028214	hsa-miR-3199	CLIP-seq
MIRT2028215	hsa-miR-4258	CLIP-seq
MIRT2028216	hsa-miR-4279	CLIP-seq
MIRT2028217	hsa-miR-4532	CLIP-seq
MIRT1103176	hsa-miR-4662a-5p	CLIP-seq
MIRT1103177	hsa-miR-4676-5p	CLIP-seq
MIRT2028218	hsa-miR-4707-3p	CLIP-seq
MIRT2028219	hsa-miR-4722-3p	CLIP-seq
MIRT2028220	hsa-miR-4740-3p	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT1103207	hsa-miR-519d	CLIP-seq
MIRT1103213	hsa-miR-520g	CLIP-seq
MIRT1103214	hsa-miR-520h	CLIP-seq
MIRT2028221	hsa-miR-552	CLIP-seq
MIRT1103179	hsa-miR-575	CLIP-seq
MIRT2028222	hsa-miR-764	CLIP-seq
MIRT2028223	hsa-miR-875-3p	CLIP-seq
MIRT1103218	hsa-miR-93	CLIP-seq
MIRT1103180	hsa-miR-106a	CLIP-seq
MIRT1103181	hsa-miR-106b	CLIP-seq
MIRT1103182	hsa-miR-1234	CLIP-seq
MIRT2028213	hsa-miR-1281	CLIP-seq
MIRT1103184	hsa-miR-150	CLIP-seq
MIRT1103185	hsa-miR-17	CLIP-seq
MIRT1103186	hsa-miR-20a	CLIP-seq
MIRT1103187	hsa-miR-20b	CLIP-seq
MIRT1103188	hsa-miR-302a	CLIP-seq
MIRT1103189	hsa-miR-302b	CLIP-seq
MIRT1103190	hsa-miR-302c	CLIP-seq
MIRT1103191	hsa-miR-302d	CLIP-seq
MIRT1103192	hsa-miR-302e	CLIP-seq
MIRT2028214	hsa-miR-3199	CLIP-seq
MIRT1103194	hsa-miR-372	CLIP-seq
MIRT1103195	hsa-miR-373	CLIP-seq
MIRT2028215	hsa-miR-4258	CLIP-seq
MIRT2028216	hsa-miR-4279	CLIP-seq
MIRT1103198	hsa-miR-4438	CLIP-seq
MIRT1103199	hsa-miR-4446-5p	CLIP-seq
MIRT2028217	hsa-miR-4532	CLIP-seq
MIRT2028218	hsa-miR-4707-3p	CLIP-seq
MIRT2028219	hsa-miR-4722-3p	CLIP-seq
MIRT1103201	hsa-miR-4731-5p	CLIP-seq
MIRT2028220	hsa-miR-4740-3p	CLIP-seq
MIRT1103202	hsa-miR-4755-5p	CLIP-seq
MIRT1103205	hsa-miR-5095	CLIP-seq
MIRT1103206	hsa-miR-512-3p	CLIP-seq
MIRT1103207	hsa-miR-519d	CLIP-seq
MIRT1103208	hsa-miR-520a-3p	CLIP-seq
MIRT1103209	hsa-miR-520b	CLIP-seq
MIRT1103210	hsa-miR-520c-3p	CLIP-seq
MIRT1103211	hsa-miR-520d-3p	CLIP-seq
MIRT1103212	hsa-miR-520e	CLIP-seq
MIRT1103213	hsa-miR-520g	CLIP-seq
MIRT1103214	hsa-miR-520h	CLIP-seq
MIRT2028221	hsa-miR-552	CLIP-seq
MIRT1103215	hsa-miR-642a	CLIP-seq
MIRT2028222	hsa-miR-764	CLIP-seq
MIRT1103218	hsa-miR-93	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT2452847	hsa-miR-141	CLIP-seq
MIRT2452848	hsa-miR-200a	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT2028215	hsa-miR-4258	CLIP-seq
MIRT2028218	hsa-miR-4707-3p	CLIP-seq
MIRT2452849	hsa-miR-4735-5p	CLIP-seq
MIRT2452850	hsa-miR-4775	CLIP-seq
MIRT2452851	hsa-miR-570	CLIP-seq
MIRT2452852	hsa-miR-590-3p	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT2028213	hsa-miR-1281	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1103175	hsa-miR-3170	CLIP-seq
MIRT2028214	hsa-miR-3199	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT2028215	hsa-miR-4258	CLIP-seq
MIRT2028216	hsa-miR-4279	CLIP-seq
MIRT2028217	hsa-miR-4532	CLIP-seq
MIRT2028218	hsa-miR-4707-3p	CLIP-seq
MIRT2028219	hsa-miR-4722-3p	CLIP-seq
MIRT2452849	hsa-miR-4735-5p	CLIP-seq
MIRT2028220	hsa-miR-4740-3p	CLIP-seq
MIRT2452850	hsa-miR-4775	CLIP-seq
MIRT1103178	hsa-miR-5096	CLIP-seq
MIRT2028221	hsa-miR-552	CLIP-seq
MIRT2452852	hsa-miR-590-3p	CLIP-seq
MIRT2028222	hsa-miR-764	CLIP-seq
MIRT1921658	hsa-miR-1273f	CLIP-seq
MIRT1103183	hsa-miR-129-5p	CLIP-seq
MIRT1921659	hsa-miR-3149	CLIP-seq
MIRT1921660	hsa-miR-411	CLIP-seq
MIRT2028215	hsa-miR-4258	CLIP-seq
MIRT2028218	hsa-miR-4707-3p	CLIP-seq
MIRT2452849	hsa-miR-4735-5p	CLIP-seq
MIRT2452850	hsa-miR-4775	CLIP-seq
MIRT2452852	hsa-miR-590-3p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005515	Function	Protein binding	IPI	10660620, 10764762, 16754721
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0070821	Component	Tertiary granule membrane	TAS

MIM	HGNC	e!Ensembl
602992	6477	ENSG00000167613

Q6GTX8

Protein name

Leukocyte-associated immunoglobulin-like receptor 1 (LAIR-1) (hLAIR1) (CD antigen CD305)

Protein function

Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosph

PDB

3KGR , 3RP1 , 7F9L , 7F9M , 7F9N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	28 → 120	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on the majority of peripheral mononuclear cells, including natural killer (NK) cells, T-cells, B-cells, monocytes, and dendritic cells. Highly expressed in naive T-cells and B-cells but no expression on germinal center B-cell

Sequence

MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRL
ERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLV
KETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLL
LVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSA
LAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH

Sequence length

287

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	22524659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	18484339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31257148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30176557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28887430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29328500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30176557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20425388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20425388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11034605, 29887420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29915163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11854595		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11699415, 16906577, 16906587, 16938520, 8751479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33053017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	31843567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36293412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37406019, 37647449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30486600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	31019980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11699415, 15329427, 15661260, 16251535, 16418492, 16434371, 16551975, 16616063, 16906577, 16906582, 16906587, 16938520, 17707831, 18288129, 18616755 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15686453, 21321292, 24415628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30483814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	34429372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29328500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26721477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	8755935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12406188, 14567725, 24332568, 31336593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29958461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35702880, 37845206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20407472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24415628	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11298550, 11854595		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	1356100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36293412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11069054, 11745387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1700749, 25915125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	11069054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11745387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25915125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15661260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29776595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29776595, 31019980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31019980, 36293412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	29328500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31080449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36960400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21151495, 22355402, 28325905	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25247291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21151495, 23093673, 28325905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11298550, 15284253, 15372481, 21657960, 9111510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	1495966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12045711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12045711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	31145313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17517179, 29776595, 29945996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17300675, 29666114, 31145313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	11468179, 14567725, 31590326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	24548186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	22355402	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	20839337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11454995, 11581182, 14567725, 28682481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	7950918, 8892685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	1672695, 8496340, 8568530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29269840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15372481, 1700749, 22932792, 30483814, 3194418, 3496601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32563267, 37858131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40000955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15622452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	26721477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	11710683, 17517179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	15622452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30483814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11034605, 11961170, 17611644, 28887430, 29328500, 7751018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	28336561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	36328145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11438490		★★★★★ ★☆☆☆☆ Found in Text Mining only

LAIR1 (leukocyte associated immunoglobulin like receptor 1)