Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	3899
Gene name	ALF transcription elongation factor 3
Gene symbol	AFF3
Synonyms (NCBI Gene)	KINSLAF4MLLT2-like
Chromosome	2
Chromosome location	2q11.2
Summary	This gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may fu

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1131692272	C>T	Pathogenic	Genic upstream transcript variant, missense variant, coding sequence variant

474

Show/Hide all (474)

miRTarBase ID	miRNA	Experiments	Reference
MIRT705859	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT705858	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT705857	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT705856	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT705855	hsa-miR-4252	HITS-CLIP	23313552
MIRT705854	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT705853	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT705852	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT705851	hsa-miR-7703	HITS-CLIP	23313552
MIRT628478	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT628477	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628476	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT628475	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT628474	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT628473	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT628478	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT628477	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628476	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT628475	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT628474	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT628473	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT705854	hsa-miR-1227-3p	HITS-CLIP	27418678
MIRT705858	hsa-miR-1273g-3p	HITS-CLIP	27418678
MIRT705855	hsa-miR-4252	HITS-CLIP	27418678
MIRT705856	hsa-miR-4793-3p	HITS-CLIP	27418678
MIRT705859	hsa-miR-508-5p	HITS-CLIP	27418678
MIRT705853	hsa-miR-6512-3p	HITS-CLIP	27418678
MIRT705852	hsa-miR-6720-5p	HITS-CLIP	27418678
MIRT705857	hsa-miR-766-3p	HITS-CLIP	27418678
MIRT705851	hsa-miR-7703	HITS-CLIP	27418678
MIRT705859	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT705858	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT705857	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT705856	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT705855	hsa-miR-4252	HITS-CLIP	23313552
MIRT705854	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT705853	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT705852	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT705851	hsa-miR-7703	HITS-CLIP	23313552
MIRT628478	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT628477	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628476	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT628475	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT628474	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT628473	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT628478	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT628477	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628476	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT628475	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT628474	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT628473	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT771077	hsa-miR-1225-3p	CLIP-seq
MIRT771078	hsa-miR-1228	CLIP-seq
MIRT771079	hsa-miR-1233	CLIP-seq
MIRT771080	hsa-miR-1246	CLIP-seq
MIRT771081	hsa-miR-1257	CLIP-seq
MIRT771082	hsa-miR-1273e	CLIP-seq
MIRT771083	hsa-miR-128	CLIP-seq
MIRT771084	hsa-miR-1285	CLIP-seq
MIRT771085	hsa-miR-1304	CLIP-seq
MIRT771086	hsa-miR-130a	CLIP-seq
MIRT771087	hsa-miR-130b	CLIP-seq
MIRT771088	hsa-miR-1915	CLIP-seq
MIRT771089	hsa-miR-199a-3p	CLIP-seq
MIRT771090	hsa-miR-199b-3p	CLIP-seq
MIRT771091	hsa-miR-24	CLIP-seq
MIRT771092	hsa-miR-2467-5p	CLIP-seq
MIRT771093	hsa-miR-300	CLIP-seq
MIRT771094	hsa-miR-301a	CLIP-seq
MIRT771095	hsa-miR-301b	CLIP-seq
MIRT771096	hsa-miR-3074-3p	CLIP-seq
MIRT771097	hsa-miR-3129-5p	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771099	hsa-miR-3176	CLIP-seq
MIRT771100	hsa-miR-3187-5p	CLIP-seq
MIRT771101	hsa-miR-3188	CLIP-seq
MIRT771102	hsa-miR-3197	CLIP-seq
MIRT771103	hsa-miR-34a	CLIP-seq
MIRT771104	hsa-miR-34b	CLIP-seq
MIRT771105	hsa-miR-34c-5p	CLIP-seq
MIRT771106	hsa-miR-3622b-5p	CLIP-seq
MIRT771107	hsa-miR-3666	CLIP-seq
MIRT771108	hsa-miR-3672	CLIP-seq
MIRT771109	hsa-miR-3689a-3p	CLIP-seq
MIRT771110	hsa-miR-3689c	CLIP-seq
MIRT771111	hsa-miR-381	CLIP-seq
MIRT771112	hsa-miR-3922-3p	CLIP-seq
MIRT771113	hsa-miR-3929	CLIP-seq
MIRT771114	hsa-miR-3942-3p	CLIP-seq
MIRT771115	hsa-miR-3945	CLIP-seq
MIRT771116	hsa-miR-3975	CLIP-seq
MIRT771117	hsa-miR-412	CLIP-seq
MIRT771118	hsa-miR-4253	CLIP-seq
MIRT771119	hsa-miR-4276	CLIP-seq
MIRT771120	hsa-miR-4284	CLIP-seq
MIRT771121	hsa-miR-4295	CLIP-seq
MIRT771122	hsa-miR-4419b	CLIP-seq
MIRT771123	hsa-miR-4420	CLIP-seq
MIRT771124	hsa-miR-4433	CLIP-seq
MIRT771125	hsa-miR-4446-3p	CLIP-seq
MIRT771126	hsa-miR-4455	CLIP-seq
MIRT771127	hsa-miR-4459	CLIP-seq
MIRT771128	hsa-miR-4478	CLIP-seq
MIRT771129	hsa-miR-4492	CLIP-seq
MIRT771130	hsa-miR-4498	CLIP-seq
MIRT771131	hsa-miR-449a	CLIP-seq
MIRT771132	hsa-miR-449b	CLIP-seq
MIRT771133	hsa-miR-4505	CLIP-seq
MIRT771134	hsa-miR-454	CLIP-seq
MIRT771135	hsa-miR-4649-3p	CLIP-seq
MIRT771136	hsa-miR-4666-3p	CLIP-seq
MIRT771137	hsa-miR-4671-3p	CLIP-seq
MIRT771138	hsa-miR-4704-3p	CLIP-seq
MIRT771139	hsa-miR-4728-5p	CLIP-seq
MIRT771140	hsa-miR-4729	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT771142	hsa-miR-4789-5p	CLIP-seq
MIRT771143	hsa-miR-485-5p	CLIP-seq
MIRT771144	hsa-miR-488	CLIP-seq
MIRT771145	hsa-miR-505	CLIP-seq
MIRT771146	hsa-miR-609	CLIP-seq
MIRT771147	hsa-miR-612	CLIP-seq
MIRT771148	hsa-miR-661	CLIP-seq
MIRT771149	hsa-miR-665	CLIP-seq
MIRT771150	hsa-miR-762	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT771152	hsa-miR-890	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT771154	hsa-miR-936	CLIP-seq
MIRT771155	hsa-miR-105	CLIP-seq
MIRT771156	hsa-miR-1205	CLIP-seq
MIRT771077	hsa-miR-1225-3p	CLIP-seq
MIRT771079	hsa-miR-1233	CLIP-seq
MIRT771082	hsa-miR-1273e	CLIP-seq
MIRT771157	hsa-miR-129-5p	CLIP-seq
MIRT771085	hsa-miR-1304	CLIP-seq
MIRT771158	hsa-miR-1323	CLIP-seq
MIRT771159	hsa-miR-148a	CLIP-seq
MIRT771160	hsa-miR-148b	CLIP-seq
MIRT771161	hsa-miR-152	CLIP-seq
MIRT771162	hsa-miR-153	CLIP-seq
MIRT771163	hsa-miR-216a	CLIP-seq
MIRT771091	hsa-miR-24	CLIP-seq
MIRT771092	hsa-miR-2467-5p	CLIP-seq
MIRT771164	hsa-miR-30a	CLIP-seq
MIRT771165	hsa-miR-30b	CLIP-seq
MIRT771166	hsa-miR-30c	CLIP-seq
MIRT771167	hsa-miR-30d	CLIP-seq
MIRT771168	hsa-miR-30e	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771101	hsa-miR-3188	CLIP-seq
MIRT771169	hsa-miR-330-3p	CLIP-seq
MIRT771170	hsa-miR-3665	CLIP-seq
MIRT771171	hsa-miR-3912	CLIP-seq
MIRT771172	hsa-miR-3926	CLIP-seq
MIRT771116	hsa-miR-3975	CLIP-seq
MIRT771173	hsa-miR-4264	CLIP-seq
MIRT771120	hsa-miR-4284	CLIP-seq
MIRT771174	hsa-miR-4293	CLIP-seq
MIRT771124	hsa-miR-4433	CLIP-seq
MIRT771125	hsa-miR-4446-3p	CLIP-seq
MIRT771126	hsa-miR-4455	CLIP-seq
MIRT771175	hsa-miR-448	CLIP-seq
MIRT771129	hsa-miR-4492	CLIP-seq
MIRT771176	hsa-miR-4493	CLIP-seq
MIRT771130	hsa-miR-4498	CLIP-seq
MIRT771133	hsa-miR-4505	CLIP-seq
MIRT771177	hsa-miR-4635	CLIP-seq
MIRT771178	hsa-miR-4639-5p	CLIP-seq
MIRT771179	hsa-miR-4753-5p	CLIP-seq
MIRT771180	hsa-miR-4761-5p	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT771181	hsa-miR-4797-3p	CLIP-seq
MIRT771143	hsa-miR-485-5p	CLIP-seq
MIRT771144	hsa-miR-488	CLIP-seq
MIRT771182	hsa-miR-548c-3p	CLIP-seq
MIRT771183	hsa-miR-548o	CLIP-seq
MIRT771146	hsa-miR-609	CLIP-seq
MIRT771184	hsa-miR-657	CLIP-seq
MIRT771149	hsa-miR-665	CLIP-seq
MIRT771150	hsa-miR-762	CLIP-seq
MIRT771185	hsa-miR-764	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT771172	hsa-miR-3926	CLIP-seq
MIRT771084	hsa-miR-1285	CLIP-seq
MIRT1927470	hsa-miR-27a	CLIP-seq
MIRT1927471	hsa-miR-27b	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771100	hsa-miR-3187-5p	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT1927472	hsa-miR-513a-5p	CLIP-seq
MIRT771147	hsa-miR-612	CLIP-seq
MIRT771148	hsa-miR-661	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT2168224	hsa-miR-1	CLIP-seq
MIRT771155	hsa-miR-105	CLIP-seq
MIRT2168225	hsa-miR-1180	CLIP-seq
MIRT2168226	hsa-miR-1197	CLIP-seq
MIRT771156	hsa-miR-1205	CLIP-seq
MIRT2168227	hsa-miR-1207-5p	CLIP-seq
MIRT2168228	hsa-miR-1208	CLIP-seq
MIRT771077	hsa-miR-1225-3p	CLIP-seq
MIRT2168229	hsa-miR-1227	CLIP-seq
MIRT771079	hsa-miR-1233	CLIP-seq
MIRT771080	hsa-miR-1246	CLIP-seq
MIRT2168230	hsa-miR-1273d	CLIP-seq
MIRT771082	hsa-miR-1273e	CLIP-seq
MIRT771083	hsa-miR-128	CLIP-seq
MIRT2168231	hsa-miR-1283	CLIP-seq
MIRT771084	hsa-miR-1285	CLIP-seq
MIRT2168232	hsa-miR-129-3p	CLIP-seq
MIRT771085	hsa-miR-1304	CLIP-seq
MIRT771086	hsa-miR-130a	CLIP-seq
MIRT771087	hsa-miR-130b	CLIP-seq
MIRT2168233	hsa-miR-134	CLIP-seq
MIRT2168234	hsa-miR-138	CLIP-seq
MIRT2168235	hsa-miR-139-5p	CLIP-seq
MIRT2168236	hsa-miR-147	CLIP-seq
MIRT771159	hsa-miR-148a	CLIP-seq
MIRT771160	hsa-miR-148b	CLIP-seq
MIRT771161	hsa-miR-152	CLIP-seq
MIRT771162	hsa-miR-153	CLIP-seq
MIRT2168237	hsa-miR-1827	CLIP-seq
MIRT2168238	hsa-miR-1909	CLIP-seq
MIRT771089	hsa-miR-199a-3p	CLIP-seq
MIRT771090	hsa-miR-199b-3p	CLIP-seq
MIRT2168239	hsa-miR-206	CLIP-seq
MIRT2168240	hsa-miR-219-5p	CLIP-seq
MIRT2168241	hsa-miR-224	CLIP-seq
MIRT2168242	hsa-miR-2278	CLIP-seq
MIRT771091	hsa-miR-24	CLIP-seq
MIRT2168243	hsa-miR-2467-3p	CLIP-seq
MIRT771092	hsa-miR-2467-5p	CLIP-seq
MIRT2168244	hsa-miR-25	CLIP-seq
MIRT2168245	hsa-miR-2681	CLIP-seq
MIRT1927470	hsa-miR-27a	CLIP-seq
MIRT1927471	hsa-miR-27b	CLIP-seq
MIRT2168246	hsa-miR-298	CLIP-seq
MIRT771094	hsa-miR-301a	CLIP-seq
MIRT771095	hsa-miR-301b	CLIP-seq
MIRT771096	hsa-miR-3074-3p	CLIP-seq
MIRT771164	hsa-miR-30a	CLIP-seq
MIRT771165	hsa-miR-30b	CLIP-seq
MIRT771166	hsa-miR-30c	CLIP-seq
MIRT771167	hsa-miR-30d	CLIP-seq
MIRT771168	hsa-miR-30e	CLIP-seq
MIRT2168247	hsa-miR-3118	CLIP-seq
MIRT2168248	hsa-miR-3123	CLIP-seq
MIRT2168249	hsa-miR-3129-3p	CLIP-seq
MIRT771097	hsa-miR-3129-5p	CLIP-seq
MIRT2168250	hsa-miR-3140-3p	CLIP-seq
MIRT2168251	hsa-miR-3150b-3p	CLIP-seq
MIRT2168252	hsa-miR-3151	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771099	hsa-miR-3176	CLIP-seq
MIRT771100	hsa-miR-3187-5p	CLIP-seq
MIRT771101	hsa-miR-3188	CLIP-seq
MIRT2168253	hsa-miR-32	CLIP-seq
MIRT2168254	hsa-miR-3202	CLIP-seq
MIRT2168255	hsa-miR-325	CLIP-seq
MIRT2168256	hsa-miR-329	CLIP-seq
MIRT2168257	hsa-miR-33a	CLIP-seq
MIRT2168258	hsa-miR-33b	CLIP-seq
MIRT771103	hsa-miR-34a	CLIP-seq
MIRT771104	hsa-miR-34b	CLIP-seq
MIRT771105	hsa-miR-34c-5p	CLIP-seq
MIRT2168259	hsa-miR-3605-5p	CLIP-seq
MIRT2168260	hsa-miR-3612	CLIP-seq
MIRT2168261	hsa-miR-3613-3p	CLIP-seq
MIRT2168262	hsa-miR-362-3p	CLIP-seq
MIRT2168263	hsa-miR-363	CLIP-seq
MIRT2168264	hsa-miR-3650	CLIP-seq
MIRT2168265	hsa-miR-3653	CLIP-seq
MIRT2168266	hsa-miR-3659	CLIP-seq
MIRT771107	hsa-miR-3666	CLIP-seq
MIRT2168267	hsa-miR-367	CLIP-seq
MIRT771108	hsa-miR-3672	CLIP-seq
MIRT2168268	hsa-miR-3673	CLIP-seq
MIRT2168269	hsa-miR-3675-3p	CLIP-seq
MIRT2168270	hsa-miR-3688-3p	CLIP-seq
MIRT771109	hsa-miR-3689a-3p	CLIP-seq
MIRT771110	hsa-miR-3689c	CLIP-seq
MIRT2168271	hsa-miR-3689d	CLIP-seq
MIRT2168272	hsa-miR-3692	CLIP-seq
MIRT2168273	hsa-miR-369-3p	CLIP-seq
MIRT2168274	hsa-miR-374a	CLIP-seq
MIRT2168275	hsa-miR-374b	CLIP-seq
MIRT2168276	hsa-miR-374c	CLIP-seq
MIRT771112	hsa-miR-3922-3p	CLIP-seq
MIRT771113	hsa-miR-3929	CLIP-seq
MIRT2168277	hsa-miR-3937	CLIP-seq
MIRT2168278	hsa-miR-3941	CLIP-seq
MIRT771116	hsa-miR-3975	CLIP-seq
MIRT2168279	hsa-miR-410	CLIP-seq
MIRT771117	hsa-miR-412	CLIP-seq
MIRT2168280	hsa-miR-4261	CLIP-seq
MIRT771173	hsa-miR-4264	CLIP-seq
MIRT2168281	hsa-miR-4270	CLIP-seq
MIRT2168282	hsa-miR-4275	CLIP-seq
MIRT2168283	hsa-miR-4283	CLIP-seq
MIRT771120	hsa-miR-4284	CLIP-seq
MIRT771174	hsa-miR-4293	CLIP-seq
MIRT771121	hsa-miR-4295	CLIP-seq
MIRT2168284	hsa-miR-4310	CLIP-seq
MIRT2168285	hsa-miR-432	CLIP-seq
MIRT771122	hsa-miR-4419b	CLIP-seq
MIRT771123	hsa-miR-4420	CLIP-seq
MIRT771124	hsa-miR-4433	CLIP-seq
MIRT2168286	hsa-miR-4436a	CLIP-seq
MIRT2168287	hsa-miR-4441	CLIP-seq
MIRT2168288	hsa-miR-4443	CLIP-seq
MIRT2168289	hsa-miR-4445	CLIP-seq
MIRT771125	hsa-miR-4446-3p	CLIP-seq
MIRT771126	hsa-miR-4455	CLIP-seq
MIRT771127	hsa-miR-4459	CLIP-seq
MIRT2168290	hsa-miR-4474-3p	CLIP-seq
MIRT771128	hsa-miR-4478	CLIP-seq
MIRT771175	hsa-miR-448	CLIP-seq
MIRT2168291	hsa-miR-4489	CLIP-seq
MIRT771129	hsa-miR-4492	CLIP-seq
MIRT771130	hsa-miR-4498	CLIP-seq
MIRT771131	hsa-miR-449a	CLIP-seq
MIRT771132	hsa-miR-449b	CLIP-seq
MIRT771133	hsa-miR-4505	CLIP-seq
MIRT2168292	hsa-miR-4533	CLIP-seq
MIRT771134	hsa-miR-454	CLIP-seq
MIRT2168293	hsa-miR-4643	CLIP-seq
MIRT2168294	hsa-miR-4646-5p	CLIP-seq
MIRT771135	hsa-miR-4649-3p	CLIP-seq
MIRT2168295	hsa-miR-4658	CLIP-seq
MIRT2168296	hsa-miR-466	CLIP-seq
MIRT771137	hsa-miR-4671-3p	CLIP-seq
MIRT2168297	hsa-miR-4672	CLIP-seq
MIRT2168298	hsa-miR-4675	CLIP-seq
MIRT2168299	hsa-miR-4677-3p	CLIP-seq
MIRT2168300	hsa-miR-4679	CLIP-seq
MIRT2168301	hsa-miR-4689	CLIP-seq
MIRT2168302	hsa-miR-4695-5p	CLIP-seq
MIRT2168303	hsa-miR-4700-3p	CLIP-seq
MIRT2168304	hsa-miR-4711-3p	CLIP-seq
MIRT2168305	hsa-miR-4718	CLIP-seq
MIRT2168306	hsa-miR-4722-5p	CLIP-seq
MIRT771139	hsa-miR-4728-5p	CLIP-seq
MIRT2168307	hsa-miR-4731-3p	CLIP-seq
MIRT2168308	hsa-miR-4732-5p	CLIP-seq
MIRT2168309	hsa-miR-4736	CLIP-seq
MIRT2168310	hsa-miR-4741	CLIP-seq
MIRT2168311	hsa-miR-4742-3p	CLIP-seq
MIRT2168312	hsa-miR-4747-5p	CLIP-seq
MIRT771180	hsa-miR-4761-5p	CLIP-seq
MIRT2168313	hsa-miR-4763-3p	CLIP-seq
MIRT2168314	hsa-miR-4782-3p	CLIP-seq
MIRT2168315	hsa-miR-4784	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT2168316	hsa-miR-4789-3p	CLIP-seq
MIRT771181	hsa-miR-4797-3p	CLIP-seq
MIRT2168317	hsa-miR-4801	CLIP-seq
MIRT771143	hsa-miR-485-5p	CLIP-seq
MIRT2168318	hsa-miR-486-5p	CLIP-seq
MIRT771144	hsa-miR-488	CLIP-seq
MIRT2168319	hsa-miR-499-3p	CLIP-seq
MIRT2168320	hsa-miR-499a-3p	CLIP-seq
MIRT771145	hsa-miR-505	CLIP-seq
MIRT2168321	hsa-miR-508-3p	CLIP-seq
MIRT2168322	hsa-miR-544	CLIP-seq
MIRT2168323	hsa-miR-586	CLIP-seq
MIRT2168324	hsa-miR-595	CLIP-seq
MIRT2168325	hsa-miR-596	CLIP-seq
MIRT2168326	hsa-miR-603	CLIP-seq
MIRT771146	hsa-miR-609	CLIP-seq
MIRT771147	hsa-miR-612	CLIP-seq
MIRT2168327	hsa-miR-613	CLIP-seq
MIRT2168328	hsa-miR-619	CLIP-seq
MIRT2168329	hsa-miR-627	CLIP-seq
MIRT2168330	hsa-miR-628-3p	CLIP-seq
MIRT2168331	hsa-miR-635	CLIP-seq
MIRT2168332	hsa-miR-650	CLIP-seq
MIRT2168333	hsa-miR-655	CLIP-seq
MIRT771148	hsa-miR-661	CLIP-seq
MIRT771149	hsa-miR-665	CLIP-seq
MIRT771150	hsa-miR-762	CLIP-seq
MIRT2168334	hsa-miR-766	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT2168335	hsa-miR-889	CLIP-seq
MIRT771152	hsa-miR-890	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT2168336	hsa-miR-924	CLIP-seq
MIRT2168337	hsa-miR-92a	CLIP-seq
MIRT2168338	hsa-miR-92b	CLIP-seq
MIRT771154	hsa-miR-936	CLIP-seq
MIRT2168339	hsa-miR-940	CLIP-seq
MIRT771084	hsa-miR-1285	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771100	hsa-miR-3187-5p	CLIP-seq
MIRT771108	hsa-miR-3672	CLIP-seq
MIRT771124	hsa-miR-4433	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT2383996	hsa-miR-490-5p	CLIP-seq
MIRT771147	hsa-miR-612	CLIP-seq
MIRT771148	hsa-miR-661	CLIP-seq
MIRT771149	hsa-miR-665	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT2443298	hsa-miR-3122	CLIP-seq
MIRT771104	hsa-miR-34b	CLIP-seq
MIRT771109	hsa-miR-3689a-3p	CLIP-seq
MIRT771110	hsa-miR-3689c	CLIP-seq
MIRT2168271	hsa-miR-3689d	CLIP-seq
MIRT2443299	hsa-miR-3913-5p	CLIP-seq
MIRT771139	hsa-miR-4728-5p	CLIP-seq
MIRT771077	hsa-miR-1225-3p	CLIP-seq
MIRT771079	hsa-miR-1233	CLIP-seq
MIRT771082	hsa-miR-1273e	CLIP-seq
MIRT2168231	hsa-miR-1283	CLIP-seq
MIRT771084	hsa-miR-1285	CLIP-seq
MIRT771085	hsa-miR-1304	CLIP-seq
MIRT771158	hsa-miR-1323	CLIP-seq
MIRT2470920	hsa-miR-1343	CLIP-seq
MIRT2168237	hsa-miR-1827	CLIP-seq
MIRT771092	hsa-miR-2467-5p	CLIP-seq
MIRT2470921	hsa-miR-299-3p	CLIP-seq
MIRT2470922	hsa-miR-3065-5p	CLIP-seq
MIRT2470923	hsa-miR-3074-5p	CLIP-seq
MIRT2443298	hsa-miR-3122	CLIP-seq
MIRT2470924	hsa-miR-3130-5p	CLIP-seq
MIRT2470925	hsa-miR-3153	CLIP-seq
MIRT771098	hsa-miR-3174	CLIP-seq
MIRT771100	hsa-miR-3187-5p	CLIP-seq
MIRT771101	hsa-miR-3188	CLIP-seq
MIRT771104	hsa-miR-34b	CLIP-seq
MIRT2168261	hsa-miR-3613-3p	CLIP-seq
MIRT2168269	hsa-miR-3675-3p	CLIP-seq
MIRT771109	hsa-miR-3689a-3p	CLIP-seq
MIRT771110	hsa-miR-3689c	CLIP-seq
MIRT2443299	hsa-miR-3913-5p	CLIP-seq
MIRT771116	hsa-miR-3975	CLIP-seq
MIRT771124	hsa-miR-4433	CLIP-seq
MIRT771127	hsa-miR-4459	CLIP-seq
MIRT2470926	hsa-miR-4482	CLIP-seq
MIRT2168294	hsa-miR-4646-5p	CLIP-seq
MIRT2470927	hsa-miR-4668-5p	CLIP-seq
MIRT2470928	hsa-miR-4684-5p	CLIP-seq
MIRT2168306	hsa-miR-4722-5p	CLIP-seq
MIRT771139	hsa-miR-4728-5p	CLIP-seq
MIRT771141	hsa-miR-4786-5p	CLIP-seq
MIRT771143	hsa-miR-485-5p	CLIP-seq
MIRT2470929	hsa-miR-548ac	CLIP-seq
MIRT2470930	hsa-miR-548ae	CLIP-seq
MIRT2470931	hsa-miR-548aj	CLIP-seq
MIRT2470932	hsa-miR-548am	CLIP-seq
MIRT2470933	hsa-miR-548d-3p	CLIP-seq
MIRT771183	hsa-miR-548o	CLIP-seq
MIRT2470934	hsa-miR-548x	CLIP-seq
MIRT2470935	hsa-miR-548z	CLIP-seq
MIRT771147	hsa-miR-612	CLIP-seq
MIRT771148	hsa-miR-661	CLIP-seq
MIRT771149	hsa-miR-665	CLIP-seq
MIRT771151	hsa-miR-769-5p	CLIP-seq
MIRT2470936	hsa-miR-802	CLIP-seq
MIRT771153	hsa-miR-921	CLIP-seq
MIRT2168339	hsa-miR-940	CLIP-seq
MIRT771158	hsa-miR-1323	CLIP-seq
MIRT2470920	hsa-miR-1343	CLIP-seq
MIRT2470921	hsa-miR-299-3p	CLIP-seq
MIRT2470922	hsa-miR-3065-5p	CLIP-seq
MIRT2470923	hsa-miR-3074-5p	CLIP-seq
MIRT2470925	hsa-miR-3153	CLIP-seq
MIRT771104	hsa-miR-34b	CLIP-seq
MIRT2168294	hsa-miR-4646-5p	CLIP-seq
MIRT2470927	hsa-miR-4668-5p	CLIP-seq
MIRT771183	hsa-miR-548o	CLIP-seq
MIRT2470936	hsa-miR-802	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IDA	8555498
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0032783	Component	Super elongation complex	IBA
GO:0034612	Process	Response to tumor necrosis factor	IMP	20444755
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IMP	18616733

MIM	HGNC	e!Ensembl
601464	6473	ENSG00000144218

P51826

Protein name

AF4/FMR2 family member 3 (Lymphoid nuclear protein related to AF4) (Protein LAF-4)

Protein function

Putative transcription activator that may function in lymphoid development and oncogenesis. Binds, in vitro, to double-stranded DNA.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05110	AF-4	20 → 173		Family
PF05110	AF-4	158 → 473		Family
PF18875	AF4_int	766 → 779	AF4 interaction motif	Motif
PF18876	AF-4_C	959 → 1226	AF-4 proto-oncoprotein C-terminal region	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in lymphoid tissues, highest levels being found in the thymus.

Sequence

MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQN
QPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEESRSGETNS
CVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
SNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGSESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAP
GSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGA
NCHRPEEPAAADALGTSVVVPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVP
KSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGSGPR
APVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKIDLTLLSRIPE
HLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSS
RPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGH
RDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQ
GPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKR
DHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPASSVGSQGSLSNAS
ALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVT
LHSSMEHLVQYSQQGLHWLRNSAHLS

Sequence length

1226

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
AFF3-associated disorder	Likely pathogenic	rs1682014084	RCV001254057	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AFF3-related neurodevelopmental disorders	Pathogenic	rs2104735114	RCV001822992	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
KINSSHIP syndrome	Pathogenic; Likely pathogenic	rs1131692272, rs2104734977, rs2104735156, rs2104735130, rs2104734930, rs2104735114, rs2546110253	RCV001391179 RCV001391180 RCV001391181 RCV001391182 RCV001391183 RCV002286850 RCV003153083 RCV001391178 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AFF3-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	17968322, 9233580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12743608, 15704140, 8555498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12743608, 15704140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20072139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19359276, 20444755, 21452313, 22328738, 23242182, 28681901, 34104118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20084005, 22328738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20072139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28601984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15704140, 28401970, 30326937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	26546613		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12743608, 15704140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23028342, 23543049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Foot Deformity	Congenital deformity of foot	BEFREE	31388108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22403184, 35986039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22403184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	25751624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28779365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	GWASCAT_DG	31527586		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	28035070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28035070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	18616733		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	19340490, 25162227, 9299237		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile arthritis	Arthritis	BEFREE	20072139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23028342, 23543049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	27647854		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8555498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22983539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38602239	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18622426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	18622426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	18622426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15704140, 28401970, 30326937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	9299237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15704140, 30326937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15704140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19340490, 9299237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12947006, 15704140, 30326937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	25162227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22403184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	12743608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	12743608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12203795, 12743608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17968322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	20084005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19359276, 20084005, 20444755, 20498205, 22983539, 23242182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	20453842, 23143596, 24782177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	20453842, 23143596, 24532676, 24782177, 26546613		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20453842, 23143596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe intellectual disability	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35478418	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28697743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38602239	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	37109656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group C	Xeroderma pigmentosum	Pubtator	37109656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AFF3 (ALF transcription elongation factor 3)