Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	389898
Gene name	Ubiquitin conjugating enzyme E2 N like (gene/pseudogene)
Gene symbol	UBE2NL
Synonyms (NCBI Gene)	Li174
Chromosome	X
Chromosome location	Xq27.3
Summary	This gene is intronless and encodes a member of the ubiquitin-conjugating enzyme family. The protein product is 91% identical to ubiquitin-conjugating enzyme E2N, a multi-exon gene product. This locus represents a polymorphic pseudogene, where some indivi

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048011	hsa-miR-30c-5p	CLASH	23622248
MIRT1468463	hsa-miR-1231	CLIP-seq
MIRT1468464	hsa-miR-128	CLIP-seq
MIRT1468465	hsa-miR-1298	CLIP-seq
MIRT1468466	hsa-miR-205	CLIP-seq
MIRT1468467	hsa-miR-224	CLIP-seq
MIRT1468468	hsa-miR-2277-3p	CLIP-seq
MIRT1468469	hsa-miR-27a	CLIP-seq
MIRT1468470	hsa-miR-27b	CLIP-seq
MIRT1468471	hsa-miR-3120-3p	CLIP-seq
MIRT1468472	hsa-miR-3179	CLIP-seq
MIRT1468473	hsa-miR-3180-5p	CLIP-seq
MIRT1468474	hsa-miR-3607-3p	CLIP-seq
MIRT1468475	hsa-miR-3686	CLIP-seq
MIRT1468476	hsa-miR-409-3p	CLIP-seq
MIRT1468477	hsa-miR-4652-5p	CLIP-seq
MIRT1468478	hsa-miR-4699-5p	CLIP-seq
MIRT1468479	hsa-miR-4724-3p	CLIP-seq
MIRT1468480	hsa-miR-4778-5p	CLIP-seq
MIRT1468481	hsa-miR-4803	CLIP-seq
MIRT1468482	hsa-miR-490-3p	CLIP-seq
MIRT1468483	hsa-miR-513a-5p	CLIP-seq
MIRT1468484	hsa-miR-520a-5p	CLIP-seq
MIRT1468485	hsa-miR-520f	CLIP-seq
MIRT1468486	hsa-miR-525-5p	CLIP-seq
MIRT1468487	hsa-miR-545	CLIP-seq
MIRT1468488	hsa-miR-549	CLIP-seq
MIRT1468489	hsa-miR-629	CLIP-seq
MIRT1468490	hsa-miR-649	CLIP-seq
MIRT1468491	hsa-miR-654-3p	CLIP-seq
MIRT1468464	hsa-miR-128	CLIP-seq
MIRT1468465	hsa-miR-1298	CLIP-seq
MIRT1468466	hsa-miR-205	CLIP-seq
MIRT1468467	hsa-miR-224	CLIP-seq
MIRT1468468	hsa-miR-2277-3p	CLIP-seq
MIRT1468469	hsa-miR-27a	CLIP-seq
MIRT1468470	hsa-miR-27b	CLIP-seq
MIRT1468471	hsa-miR-3120-3p	CLIP-seq
MIRT1468479	hsa-miR-4724-3p	CLIP-seq
MIRT1468483	hsa-miR-513a-5p	CLIP-seq
MIRT1468485	hsa-miR-520f	CLIP-seq
MIRT1468487	hsa-miR-545	CLIP-seq
MIRT2361718	hsa-miR-2392	CLIP-seq
MIRT1468473	hsa-miR-3180-5p	CLIP-seq
MIRT1468481	hsa-miR-4803	CLIP-seq
MIRT1468484	hsa-miR-520a-5p	CLIP-seq
MIRT1468486	hsa-miR-525-5p	CLIP-seq
MIRT2462801	hsa-miR-186	CLIP-seq
MIRT2462802	hsa-miR-3133	CLIP-seq
MIRT2462803	hsa-miR-4263	CLIP-seq
MIRT2462804	hsa-miR-4509	CLIP-seq
MIRT2462805	hsa-miR-4511	CLIP-seq
MIRT2462806	hsa-miR-4744	CLIP-seq
MIRT2462807	hsa-miR-4799-5p	CLIP-seq
MIRT2462808	hsa-miR-576-5p	CLIP-seq
MIRT2462809	hsa-miR-582-3p	CLIP-seq
MIRT2655591	hsa-miR-1275	CLIP-seq
MIRT1468464	hsa-miR-128	CLIP-seq
MIRT1468465	hsa-miR-1298	CLIP-seq
MIRT1468466	hsa-miR-205	CLIP-seq
MIRT2655592	hsa-miR-21	CLIP-seq
MIRT1468467	hsa-miR-224	CLIP-seq
MIRT2361718	hsa-miR-2392	CLIP-seq
MIRT1468469	hsa-miR-27a	CLIP-seq
MIRT1468470	hsa-miR-27b	CLIP-seq
MIRT2655593	hsa-miR-3174	CLIP-seq
MIRT1468473	hsa-miR-3180-5p	CLIP-seq
MIRT2655594	hsa-miR-34a	CLIP-seq
MIRT2655595	hsa-miR-34c-5p	CLIP-seq
MIRT2655596	hsa-miR-3606	CLIP-seq
MIRT2655597	hsa-miR-3616-3p	CLIP-seq
MIRT2655598	hsa-miR-3646	CLIP-seq
MIRT2655599	hsa-miR-4436b-3p	CLIP-seq
MIRT2655600	hsa-miR-4457	CLIP-seq
MIRT2655601	hsa-miR-449a	CLIP-seq
MIRT2655602	hsa-miR-449b	CLIP-seq
MIRT2655603	hsa-miR-4525	CLIP-seq
MIRT2655604	hsa-miR-4665-5p	CLIP-seq
MIRT2655605	hsa-miR-4698	CLIP-seq
MIRT2655606	hsa-miR-4721	CLIP-seq
MIRT2655607	hsa-miR-4723-5p	CLIP-seq
MIRT1468479	hsa-miR-4724-3p	CLIP-seq
MIRT1468481	hsa-miR-4803	CLIP-seq
MIRT1468483	hsa-miR-513a-5p	CLIP-seq
MIRT2655608	hsa-miR-513b	CLIP-seq
MIRT1468484	hsa-miR-520a-5p	CLIP-seq
MIRT1468485	hsa-miR-520f	CLIP-seq
MIRT2655609	hsa-miR-522	CLIP-seq
MIRT1468486	hsa-miR-525-5p	CLIP-seq
MIRT1468488	hsa-miR-549	CLIP-seq
MIRT2655610	hsa-miR-590-5p	CLIP-seq
MIRT2655611	hsa-miR-625	CLIP-seq
MIRT2655612	hsa-miR-921	CLIP-seq
MIRT2655591	hsa-miR-1275	CLIP-seq
MIRT1468464	hsa-miR-128	CLIP-seq
MIRT1468465	hsa-miR-1298	CLIP-seq
MIRT1468466	hsa-miR-205	CLIP-seq
MIRT2655592	hsa-miR-21	CLIP-seq
MIRT1468467	hsa-miR-224	CLIP-seq
MIRT2361718	hsa-miR-2392	CLIP-seq
MIRT1468469	hsa-miR-27a	CLIP-seq
MIRT1468470	hsa-miR-27b	CLIP-seq
MIRT2655593	hsa-miR-3174	CLIP-seq
MIRT1468473	hsa-miR-3180-5p	CLIP-seq
MIRT2655594	hsa-miR-34a	CLIP-seq
MIRT2655595	hsa-miR-34c-5p	CLIP-seq
MIRT2655596	hsa-miR-3606	CLIP-seq
MIRT2655597	hsa-miR-3616-3p	CLIP-seq
MIRT2694655	hsa-miR-3617	CLIP-seq
MIRT2655598	hsa-miR-3646	CLIP-seq
MIRT2694656	hsa-miR-376c	CLIP-seq
MIRT2694657	hsa-miR-4436a	CLIP-seq
MIRT2655599	hsa-miR-4436b-3p	CLIP-seq
MIRT2655600	hsa-miR-4457	CLIP-seq
MIRT2655601	hsa-miR-449a	CLIP-seq
MIRT2655602	hsa-miR-449b	CLIP-seq
MIRT2655603	hsa-miR-4525	CLIP-seq
MIRT2694658	hsa-miR-4645-3p	CLIP-seq
MIRT2655604	hsa-miR-4665-5p	CLIP-seq
MIRT2655605	hsa-miR-4698	CLIP-seq
MIRT2655606	hsa-miR-4721	CLIP-seq
MIRT2655607	hsa-miR-4723-5p	CLIP-seq
MIRT1468479	hsa-miR-4724-3p	CLIP-seq
MIRT1468481	hsa-miR-4803	CLIP-seq
MIRT1468483	hsa-miR-513a-5p	CLIP-seq
MIRT2655608	hsa-miR-513b	CLIP-seq
MIRT1468484	hsa-miR-520a-5p	CLIP-seq
MIRT1468485	hsa-miR-520f	CLIP-seq
MIRT2655609	hsa-miR-522	CLIP-seq
MIRT1468486	hsa-miR-525-5p	CLIP-seq
MIRT1468488	hsa-miR-549	CLIP-seq
MIRT2655610	hsa-miR-590-5p	CLIP-seq
MIRT2655611	hsa-miR-625	CLIP-seq
MIRT2694659	hsa-miR-641	CLIP-seq
MIRT2655612	hsa-miR-921	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0005634	Component	Nucleus	IBA
GO:0006301	Process	Postreplication repair	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070534	Process	Protein K63-linked ubiquitination	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5JXB2

Protein name

Putative ubiquitin-conjugating enzyme E2 N-like (Epididymis tissue protein Li 174)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	7 → 145	Ubiquitin-conjugating enzyme	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.

Sequence

MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLA
EEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDD
PLANDVVEQWKTNEAQAIETARAWTRLYAMNSI

Sequence length

153

Interactions

View interactions

	KEGG
	Ubiquitin mediated proteolysis Shigellosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Gastroschisis	Gastroschisis	Pubtator	32163230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28185054		★★★★★ ★☆☆☆☆ Found in Text Mining only

UBE2NL (ubiquitin conjugating enzyme E2 N like (gene/pseudogene))