Gene Gene information from NCBI Gene database.
Entrez ID 389421
Gene name Lin-28 RNA binding posttranscriptional regulator B
Gene symbol LIN28B
Synonyms (NCBI Gene)
CSDD2
Chromosome 6
Chromosome location 6q16.3-q21
Summary The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumor
miRNA miRNA information provided by mirtarbase database.
328
miRTarBase ID miRNA Experiments Reference
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
TBP Activation 23494474
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IDA 19703396
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611044 32207 ENSG00000187772
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZN17
Protein name Protein lin-28 homolog B (Lin-28B)
Protein function Suppressor of microRNA (miRNA) biogenesis, including that of let-7 and possibly of miR107, miR-143 and miR-200c. Binds primary let-7 transcripts (pri-let-7), including pri-let-7g and pri-let-7a-1, and sequester them in the nucleolus, away from t
PDB 4A4I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 30 102 Domain
PF00098 zf-CCHC 127 144 Zinc knuckle Domain
PF00098 zf-CCHC 149 166 Zinc knuckle Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the placenta and, at mucher lower, in testis and fetal liver (PubMed:16971064). Isoform 1 is only detected in placenta and in moderately and poorly differentiated hepatocellular carcinoma cells (at protein l
Sequence
MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGP
GGSPCLGSERRPKGKTLQ
KRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQ
EAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKK
GPSVQKRKKT
Sequence length 250
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASPHYXIA NEONATORUM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GALLSTONES GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute monocytic leukemia Monocytic Leukemia BEFREE 28011885, 28693523
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29301498, 29503447, 30353165, 30535503
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 25200669
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 24847876, 27039094
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 30953666
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 27180906, 28947981, 29748571
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Abdominal Aortic aneurysm Pubtator 37822152 Associate
★☆☆☆☆
Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor Teratoid Rhabdoid Tumor BEFREE 25638158, 27039094
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 29669301
★☆☆☆☆
Found in Text Mining only
Benign Neoplasm Benign Neoplasm CTD_human_DG 19483683
★☆☆☆☆
Found in Text Mining only