Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	389421
Gene name	Lin-28 RNA binding posttranscriptional regulator B
Gene symbol	LIN28B
Synonyms (NCBI Gene)	CSDD2
Chromosome	6
Chromosome location	6q16.3-q21
Summary	The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumor

328

Show/Hide all (328)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Microarray	17699775
MIRT005804	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	20827722
MIRT019513	hsa-miR-151a-3p	Sequencing	20371350
MIRT026096	hsa-miR-196a-5p	Sequencing	20371350
MIRT032185	hsa-let-7d-5p	Sequencing	20371350
MIRT048544	hsa-miR-100-5p	CLASH	23622248
MIRT046425	hsa-miR-15b-5p	CLASH	23622248
MIRT045709	hsa-miR-125a-5p	CLASH	23622248
MIRT042267	hsa-miR-484	CLASH	23622248
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT566935	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT566934	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT566933	hsa-miR-3133	PAR-CLIP	20371350
MIRT566932	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT566931	hsa-miR-3927-3p	PAR-CLIP	20371350
MIRT566930	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT566929	hsa-miR-6076	PAR-CLIP	20371350
MIRT566928	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT566927	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT566926	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566925	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT556552	hsa-miR-4453	PAR-CLIP	21572407
MIRT556551	hsa-miR-4538	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT556550	hsa-miR-323a-5p	PAR-CLIP	21572407
MIRT556549	hsa-miR-876-3p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT556548	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT547609	hsa-miR-3163	PAR-CLIP	21572407
MIRT547608	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT547607	hsa-miR-5692b	PAR-CLIP	21572407
MIRT547606	hsa-miR-5692c	PAR-CLIP	21572407
MIRT547605	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547604	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT547603	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT547602	hsa-miR-5681b	PAR-CLIP	21572407
MIRT547601	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT547600	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT547599	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT547597	hsa-miR-6083	PAR-CLIP	21572407
MIRT547598	hsa-miR-498	PAR-CLIP	21572407
MIRT547595	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT547596	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547594	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT547592	hsa-miR-4718	PAR-CLIP	21572407
MIRT547593	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT547591	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT547590	hsa-miR-2681-5p	PAR-CLIP	21572407
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT727310	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727309	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727308	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727307	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727306	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT732354	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	28218277
MIRT732354	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	28218277
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26787543
MIRT734887	hsa-let-7a-3p	qRT-PCRImmunocytochemistry (ICC)	33379329
MIRT736230	hsa-miR-152-3p	Luciferase reporter assayWestern blottingqRT-PCR	31609010
MIRT734887	hsa-let-7a-3p	Western blottingImmunohistochemistry (IHC)qRT-PCR	32046465
MIRT566935	hsa-miR-379-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqImmunofluorescenceqRT-PCRIn situ hybridization	31907362
MIRT566935	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT566934	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT566933	hsa-miR-3133	PAR-CLIP	20371350
MIRT566932	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT566931	hsa-miR-3927-3p	PAR-CLIP	20371350
MIRT566930	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT566929	hsa-miR-6076	PAR-CLIP	20371350
MIRT566928	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT566927	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT566926	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566925	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT556552	hsa-miR-4453	PAR-CLIP	21572407
MIRT556551	hsa-miR-4538	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT556550	hsa-miR-323a-5p	PAR-CLIP	21572407
MIRT556549	hsa-miR-876-3p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT556548	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT547609	hsa-miR-3163	PAR-CLIP	21572407
MIRT547608	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT547607	hsa-miR-5692b	PAR-CLIP	21572407
MIRT547606	hsa-miR-5692c	PAR-CLIP	21572407
MIRT547605	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547604	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT547603	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT547602	hsa-miR-5681b	PAR-CLIP	21572407
MIRT547601	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT547600	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT547599	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT547597	hsa-miR-6083	PAR-CLIP	21572407
MIRT547598	hsa-miR-498	PAR-CLIP	21572407
MIRT547595	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT547596	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547594	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT547592	hsa-miR-4718	PAR-CLIP	21572407
MIRT547593	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT547591	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT547590	hsa-miR-2681-5p	PAR-CLIP	21572407
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT756034	hsa-miR-99b-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)RNA-seq	34998954
MIRT1110149	hsa-miR-101	CLIP-seq
MIRT1110150	hsa-miR-1229	CLIP-seq
MIRT1110151	hsa-miR-1253	CLIP-seq
MIRT1110152	hsa-miR-128	CLIP-seq
MIRT1110153	hsa-miR-1297	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT1110155	hsa-miR-144	CLIP-seq
MIRT1110156	hsa-miR-1827	CLIP-seq
MIRT1110157	hsa-miR-199a-3p	CLIP-seq
MIRT1110158	hsa-miR-199b-3p	CLIP-seq
MIRT1110159	hsa-miR-200b	CLIP-seq
MIRT1110160	hsa-miR-200c	CLIP-seq
MIRT1110161	hsa-miR-205	CLIP-seq
MIRT1110162	hsa-miR-218	CLIP-seq
MIRT1110163	hsa-miR-219-1-3p	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT1110167	hsa-miR-26a	CLIP-seq
MIRT1110168	hsa-miR-26b	CLIP-seq
MIRT1110169	hsa-miR-27a	CLIP-seq
MIRT1110170	hsa-miR-27b	CLIP-seq
MIRT1110171	hsa-miR-3127-3p	CLIP-seq
MIRT1110172	hsa-miR-3129-5p	CLIP-seq
MIRT1110173	hsa-miR-3145-3p	CLIP-seq
MIRT1110174	hsa-miR-3145-5p	CLIP-seq
MIRT1110175	hsa-miR-3155	CLIP-seq
MIRT1110176	hsa-miR-3155b	CLIP-seq
MIRT1110177	hsa-miR-3173-3p	CLIP-seq
MIRT1110178	hsa-miR-329	CLIP-seq
MIRT1110179	hsa-miR-342-3p	CLIP-seq
MIRT1110180	hsa-miR-3617	CLIP-seq
MIRT1110181	hsa-miR-362-3p	CLIP-seq
MIRT1110182	hsa-miR-3650	CLIP-seq
MIRT1110183	hsa-miR-3682-5p	CLIP-seq
MIRT1110184	hsa-miR-3689a-5p	CLIP-seq
MIRT1110185	hsa-miR-3689b	CLIP-seq
MIRT1110186	hsa-miR-3689e	CLIP-seq
MIRT1110187	hsa-miR-3689f	CLIP-seq
MIRT1110188	hsa-miR-3941	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT1110190	hsa-miR-4276	CLIP-seq
MIRT1110191	hsa-miR-4287	CLIP-seq
MIRT1110192	hsa-miR-429	CLIP-seq
MIRT1110193	hsa-miR-4292	CLIP-seq
MIRT1110194	hsa-miR-4308	CLIP-seq
MIRT1110195	hsa-miR-4428	CLIP-seq
MIRT1110196	hsa-miR-4455	CLIP-seq
MIRT1110197	hsa-miR-4465	CLIP-seq
MIRT1110198	hsa-miR-4469	CLIP-seq
MIRT1110199	hsa-miR-4649-3p	CLIP-seq
MIRT1110200	hsa-miR-4685-3p	CLIP-seq
MIRT1110201	hsa-miR-4699-5p	CLIP-seq
MIRT1110202	hsa-miR-4712-3p	CLIP-seq
MIRT1110203	hsa-miR-4713-5p	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT1110205	hsa-miR-4753-3p	CLIP-seq
MIRT1110206	hsa-miR-4756-3p	CLIP-seq
MIRT1110207	hsa-miR-4768-5p	CLIP-seq
MIRT1110208	hsa-miR-4775	CLIP-seq
MIRT1110209	hsa-miR-4779	CLIP-seq
MIRT1110210	hsa-miR-501-3p	CLIP-seq
MIRT1110211	hsa-miR-502-3p	CLIP-seq
MIRT1110212	hsa-miR-508-5p	CLIP-seq
MIRT1110213	hsa-miR-510	CLIP-seq
MIRT1110214	hsa-miR-511	CLIP-seq
MIRT1110215	hsa-miR-520a-5p	CLIP-seq
MIRT1110216	hsa-miR-525-5p	CLIP-seq
MIRT1110217	hsa-miR-544b	CLIP-seq
MIRT1110218	hsa-miR-548ac	CLIP-seq
MIRT1110219	hsa-miR-548ae	CLIP-seq
MIRT1110220	hsa-miR-548aj	CLIP-seq
MIRT1110221	hsa-miR-548am	CLIP-seq
MIRT1110222	hsa-miR-548d-3p	CLIP-seq
MIRT1110223	hsa-miR-548x	CLIP-seq
MIRT1110224	hsa-miR-548z	CLIP-seq
MIRT1110225	hsa-miR-579	CLIP-seq
MIRT1110226	hsa-miR-582-5p	CLIP-seq
MIRT1110227	hsa-miR-583	CLIP-seq
MIRT1110228	hsa-miR-587	CLIP-seq
MIRT1110229	hsa-miR-590-3p	CLIP-seq
MIRT1110230	hsa-miR-603	CLIP-seq
MIRT1110231	hsa-miR-629	CLIP-seq
MIRT1110232	hsa-miR-636	CLIP-seq
MIRT1110233	hsa-miR-641	CLIP-seq
MIRT1110234	hsa-miR-936	CLIP-seq
MIRT1922218	hsa-miR-1206	CLIP-seq
MIRT1922219	hsa-miR-4793-5p	CLIP-seq
MIRT1922220	hsa-miR-486-5p	CLIP-seq
MIRT2030679	hsa-let-7a	CLIP-seq
MIRT2030680	hsa-let-7b	CLIP-seq
MIRT2030681	hsa-let-7c	CLIP-seq
MIRT2030682	hsa-let-7d	CLIP-seq
MIRT2030683	hsa-let-7e	CLIP-seq
MIRT2030684	hsa-let-7f	CLIP-seq
MIRT2030685	hsa-let-7g	CLIP-seq
MIRT2030686	hsa-let-7i	CLIP-seq
MIRT1110150	hsa-miR-1229	CLIP-seq
MIRT2030687	hsa-miR-1303	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT2030688	hsa-miR-3125	CLIP-seq
MIRT2030689	hsa-miR-3591-3p	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2030691	hsa-miR-377	CLIP-seq
MIRT2030692	hsa-miR-3916	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT2030693	hsa-miR-4458	CLIP-seq
MIRT2030694	hsa-miR-4500	CLIP-seq
MIRT2030695	hsa-miR-4639-3p	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT2030696	hsa-miR-5096	CLIP-seq
MIRT2030697	hsa-miR-518a-5p	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030700	hsa-miR-527	CLIP-seq
MIRT1110218	hsa-miR-548ac	CLIP-seq
MIRT1110219	hsa-miR-548ae	CLIP-seq
MIRT2030701	hsa-miR-548ag	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2030703	hsa-miR-548ai	CLIP-seq
MIRT1110220	hsa-miR-548aj	CLIP-seq
MIRT1110221	hsa-miR-548am	CLIP-seq
MIRT1110222	hsa-miR-548d-3p	CLIP-seq
MIRT2030704	hsa-miR-548m	CLIP-seq
MIRT1110223	hsa-miR-548x	CLIP-seq
MIRT1110224	hsa-miR-548z	CLIP-seq
MIRT2030705	hsa-miR-659	CLIP-seq
MIRT2030706	hsa-miR-877	CLIP-seq
MIRT2030707	hsa-miR-9	CLIP-seq
MIRT2030708	hsa-miR-98	CLIP-seq
MIRT2030679	hsa-let-7a	CLIP-seq
MIRT2030680	hsa-let-7b	CLIP-seq
MIRT2030681	hsa-let-7c	CLIP-seq
MIRT2030682	hsa-let-7d	CLIP-seq
MIRT2030683	hsa-let-7e	CLIP-seq
MIRT2030684	hsa-let-7f	CLIP-seq
MIRT2030685	hsa-let-7g	CLIP-seq
MIRT2030686	hsa-let-7i	CLIP-seq
MIRT1922218	hsa-miR-1206	CLIP-seq
MIRT2030687	hsa-miR-1303	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT2261384	hsa-miR-202	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT2261385	hsa-miR-30a	CLIP-seq
MIRT2261386	hsa-miR-30b	CLIP-seq
MIRT2261387	hsa-miR-30c	CLIP-seq
MIRT2261388	hsa-miR-30d	CLIP-seq
MIRT2261389	hsa-miR-30e	CLIP-seq
MIRT2261390	hsa-miR-3123	CLIP-seq
MIRT2261391	hsa-miR-3529	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2261392	hsa-miR-3613-3p	CLIP-seq
MIRT2261393	hsa-miR-379	CLIP-seq
MIRT2261394	hsa-miR-3925-5p	CLIP-seq
MIRT2261395	hsa-miR-3927	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT2030693	hsa-miR-4458	CLIP-seq
MIRT2030694	hsa-miR-4500	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT2261396	hsa-miR-4733-5p	CLIP-seq
MIRT2261397	hsa-miR-494	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2261398	hsa-miR-570	CLIP-seq
MIRT2261399	hsa-miR-577	CLIP-seq
MIRT2030708	hsa-miR-98	CLIP-seq
MIRT2390157	hsa-miR-320e	CLIP-seq
MIRT1110179	hsa-miR-342-3p	CLIP-seq
MIRT2390158	hsa-miR-380	CLIP-seq
MIRT2390159	hsa-miR-4457	CLIP-seq
MIRT2390160	hsa-miR-4490	CLIP-seq
MIRT2390161	hsa-miR-4495	CLIP-seq
MIRT2390162	hsa-miR-513b	CLIP-seq
MIRT2390163	hsa-miR-618	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT2453063	hsa-miR-3164	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2453064	hsa-miR-3973	CLIP-seq
MIRT2453065	hsa-miR-4452	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2453066	hsa-miR-607	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TBP	Activation	23494474

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IDA	19703396
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	19703396
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010587	Process	MiRNA catabolic process	IEA
GO:0010587	Process	MiRNA catabolic process	IMP	19703396
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031054	Process	Pre-miRNA processing	IBA
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0031054	Process	Pre-miRNA processing	IMP	19703396
GO:0031123	Process	RNA 3'-end processing	IEA
GO:0031123	Process	RNA 3'-end processing	IMP	19703396
GO:0046872	Function	Metal ion binding	IEA
GO:0050779	Process	RNA destabilization	IDA	18951094
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000627	Process	Positive regulation of miRNA catabolic process	IMP	18951094
GO:2000632	Process	Negative regulation of pre-miRNA processing	IDA	18951094
GO:2000632	Process	Negative regulation of pre-miRNA processing	IEA
GO:2000635	Process	Negative regulation of primary miRNA processing	IDA	18951094

MIM	HGNC	e!Ensembl
611044	32207	ENSG00000187772

Q6ZN17

Protein name

Protein lin-28 homolog B (Lin-28B)

Protein function

Suppressor of microRNA (miRNA) biogenesis, including that of let-7 and possibly of miR107, miR-143 and miR-200c. Binds primary let-7 transcripts (pri-let-7), including pri-let-7g and pri-let-7a-1, and sequester them in the nucleolus, away from t

PDB

4A4I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00313	CSD	30 → 102		Domain
PF00098	zf-CCHC	127 → 144	Zinc knuckle	Domain
PF00098	zf-CCHC	149 → 166	Zinc knuckle	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the placenta and, at mucher lower, in testis and fetal liver (PubMed:16971064). Isoform 1 is only detected in placenta and in moderately and poorly differentiated hepatocellular carcinoma cells (at protein l

Sequence

MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQ
KRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQ
EAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKK
GPSVQKRKKT

Sequence length

250

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASPHYXIA NEONATORUM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (132)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28011885, 28693523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29301498, 29503447, 30353165, 30535503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25200669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24847876, 27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30953666		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27180906, 28947981, 29748571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	37822152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	25638158, 27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29669301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	19483683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26028027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22081076, 23494474, 24885919, 25744721, 30742065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24885919, 31907362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26325594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22225612, 24885919, 26080928, 26123663, 26481147, 29330293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25200669, 25201220, 25368430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24885919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24244607, 26080928, 29466730, 32571380, 33228611, 37269361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26028027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25744721, 28218277, 28603287, 29503447, 29950144, 31766078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26158423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30917918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19477633, 21482675, 21533284, 22822098, 26158423, 26751131, 30174831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24847876, 27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34548635, 34837926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30958882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	22964795, 28525351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23052130, 25360631, 27793004, 29669301, 29725425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	25360631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21625210	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23052130, 25956904, 29330293, 31713927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21625210, 23052130, 25360631, 27793004, 29330293, 31510013, 32828126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26305337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	29724816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21962509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21962509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31609010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoblastoma	Ependymoblastoma	BEFREE	27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19477633, 21482675, 22822098, 26751131, 30174831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28536261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23420006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	29724816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	32571380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	32571380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	29507645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	22882789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	36828304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26787543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30742065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	29724816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24885919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	26712910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35689443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24232254, 28693523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34793513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	26712910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28011885, 28693523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16971064, 20525879, 20827722, 23318446, 24244607, 29466730, 29689270, 31762817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23318446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19745602, 28218277, 28603287, 29950144, 31766078, 37269361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31766078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22433967	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28947981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36999462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27479909		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	29791834		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	26123663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22081076, 23494474, 24885919, 25744721, 30742065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22433967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30953666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25744721, 28218277, 28603287, 29503447, 29950144, 31766078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25503985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21533284, 22822098, 26158423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25201220, 26501150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29787985, 29970131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26028027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16971064, 19483683, 22118463, 22713243, 22822098, 22976955, 23042116, 23420006, 24244607, 25301052, 25633261, 25744721, 26123544, 27821801, 28482074 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	19483683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23052130, 25360631, 27793004, 29669301, 29725425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22118463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	25655194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24847876, 27039094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37083768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25277211, 26071398, 28482074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28482074, 34424910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25503985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25503985	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27773931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36059274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19477633, 20525879, 21482675, 23482325, 24244607, 24958470, 25360631, 25726847, 26123544, 26123663, 26917013, 27821801, 28218277, 28603287, 28693523 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	19483683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	24732380, 28301057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	ORPHANET_DG	22911191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19495417, 22941191, 23222812, 25312269, 26123663, 26481147, 27021521, 30375995, 32707690, 34779407, 34998954, 37991019	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	ORPHANET_DG	22911191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	22941191, 23042116, 23222812, 25312269, 25415050, 26123663, 27021521, 27383785, 29024823, 29241071, 31601998		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	22941191, 23042116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	GWASCAT_DG	22941191, 28545128		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	GWASDB_DG	22941191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24780874, 24958470, 25368430, 27821801, 30429015, 31638206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20962026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23129384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21533284, 22822098, 26158423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21533284, 25188517, 26158423, 30154460, 32627014, 36495291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28947981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33107691	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	36828304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22876539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	28525351, 30053798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25201220, 26501150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25201220, 35983819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	28189638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24386298, 31147574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	31147574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31079917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24386298, 25726847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28381191, 36999462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29787985, 29970131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25197381, 29970131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	29724816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	25762640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22118463, 35711895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33516780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	35273655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28301057	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28301057, 28825729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LIN28B (lin-28 RNA binding posttranscriptional regulator B)