Gene Gene information from NCBI Gene database.
Entrez ID 389400
Gene name GDNF family receptor alpha like
Gene symbol GFRAL
Synonyms (NCBI Gene)
C6orf144GRALUNQ9356bA360D14.1
Chromosome 6
Chromosome location 6p12.1
miRNA miRNA information provided by mirtarbase database.
198
miRTarBase ID miRNA Experiments Reference
MIRT488930 hsa-miR-5197-3p PAR-CLIP 23592263
MIRT488928 hsa-miR-6758-5p PAR-CLIP 23592263
MIRT488927 hsa-miR-6856-5p PAR-CLIP 23592263
MIRT488926 hsa-miR-1253 PAR-CLIP 23592263
MIRT488925 hsa-miR-3150b-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0002023 Process Reduction of food intake in response to dietary excess IEA
GO:0002023 Process Reduction of food intake in response to dietary excess ISS
GO:0005179 Function Hormone activity IEA
GO:0005515 Function Protein binding IPI 28846097, 28846098, 28846099, 28953886
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617837 32789 ENSG00000187871
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXV0
Protein name GDNF family receptor alpha-like
Protein function Brainstem-restricted receptor for GDF15 hormone, which triggers an aversive response, characterized by nausea, vomiting, and/or loss of appetite in response to various stresses (PubMed:28846097, PubMed:28846098, PubMed:28846099, PubMed:28953886,
PDB 5VZ4 , 6Q2J , 6WMW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02351 GDNF 131 210 GDNF/GAS1 domain Domain
PF02351 GDNF 220 316 GDNF/GAS1 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius (at protein level) (PubMed:28846097, PubMed:28846098). Detected at low levels in testis and adip
Sequence
MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKM
RNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTR
SHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPF
NIAQMLAFCDCAQSDIPCQQSKEALHSKTC
AVNMVPPPTCLSVIRSCQNDELCRRHYRTF
QSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSE
ESLCKIFQHMLHRKSC
FNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMT
VTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL
Sequence length 394
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anorexia Anorexia BEFREE 30382947
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia Pubtator 30772304 Associate
★☆☆☆☆
Found in Text Mining only
Blood Platelet Disorders Platelet disorder Pubtator 38254638 Associate
★☆☆☆☆
Found in Text Mining only
Cachexia Cachexia Pubtator 30772304 Associate
★☆☆☆☆
Found in Text Mining only
Insulin Resistance Diabetes mellitus, type 2 Pubtator 33302552 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Obesity Obesity BEFREE 28846097, 28846099, 30639358
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 33302552 Associate
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach neoplasms Pubtator 37260027 Associate
★☆☆☆☆
Found in Text Mining only