TMPRSS11F (transmembrane serine protease 11F)

Gene

• Entrez ID: 389208
• Gene name: Transmembrane serine protease 11F
• Gene symbol: TMPRSS11F
• Synonyms (NCBI Gene): HATL4
• Chromosome: 4
• Chromosome location: 4q13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1440976	hsa-let-7a	CLIP-seq
MIRT1440977	hsa-let-7b	CLIP-seq
MIRT1440978	hsa-let-7c	CLIP-seq
MIRT1440979	hsa-let-7d	CLIP-seq
MIRT1440980	hsa-let-7e	CLIP-seq
MIRT1440981	hsa-let-7f	CLIP-seq
MIRT1440982	hsa-let-7g	CLIP-seq
MIRT1440983	hsa-let-7i	CLIP-seq
MIRT1440984	hsa-miR-1271	CLIP-seq
MIRT739940	hsa-miR-1297	CLIP-seq
MIRT1440985	hsa-miR-182	CLIP-seq
MIRT1440986	hsa-miR-202	CLIP-seq
MIRT1440987	hsa-miR-2115	CLIP-seq
MIRT739942	hsa-miR-26a	CLIP-seq
MIRT739941	hsa-miR-26b	CLIP-seq
MIRT1440988	hsa-miR-3120-5p	CLIP-seq
MIRT1440989	hsa-miR-4458	CLIP-seq
MIRT739939	hsa-miR-4465	CLIP-seq
MIRT1440990	hsa-miR-4500	CLIP-seq
MIRT1440991	hsa-miR-4678	CLIP-seq
MIRT1440992	hsa-miR-516a-3p	CLIP-seq
MIRT739938	hsa-miR-605	CLIP-seq
MIRT1440993	hsa-miR-616	CLIP-seq
MIRT1440994	hsa-miR-626	CLIP-seq
MIRT1440995	hsa-miR-96	CLIP-seq
MIRT1440996	hsa-miR-98	CLIP-seq
MIRT2353165	hsa-miR-4457	CLIP-seq
MIRT2353166	hsa-miR-513b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	28338078
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0061436	Process	Establishment of skin barrier	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6ZWK6
• Protein name: Transmembrane protease serine 11F (EC 3.4.21.-) (Airway trypsin-like protease 4)
• Protein function: Probable serine protease.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01390	SEA	59 → 164	SEA domain	Family
  PF00089	Trypsin	206 → 432	Trypsin	Domain

• Sequence:

  MMYAPVEFSEAEFSRAEYQRKQQFWDSVRLALFTLAIVAIIGIAIGIVTHFVVEDDKSFY
  YLASFKVTNIKYKENYGIRSSREFIERSHQIERMMSRIFRHSSVGGRFIKSHVIKLSPDE
  QGVDILIVLIFRYPSTDSAEQIKKKIEKALYQSLKTKQLSLTINKPSFRLTPIDSKKMRN
  LLNSRCGIRMTSSNMPLPASSSTQRIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISN
  TWLLTAAHCFWKNKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLS
  TGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNR
  KDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPKKPG
  VYTRVTKYRDWIASKTGM

• Sequence length: 438

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30843660		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30843660		★☆☆☆☆ Found in Text Mining only