Gene Gene information from NCBI Gene database.
Entrez ID 389058
Gene name Sp5 transcription factor
Gene symbol SP5
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q31.1
miRNA miRNA information provided by mirtarbase database.
52
miRTarBase ID miRNA Experiments Reference
MIRT1381507 hsa-miR-103a CLIP-seq
MIRT1381508 hsa-miR-107 CLIP-seq
MIRT1381509 hsa-miR-125a-5p CLIP-seq
MIRT1381510 hsa-miR-125b CLIP-seq
MIRT1381511 hsa-miR-1293 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609391 14529 ENSG00000204335
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6BEB4
Protein name Transcription factor Sp5
Protein function Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 296 320 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 326 350 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 356 378 Zinc finger, C2H2 type Domain
Sequence
MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYD
PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGAPHAPRFPASAAAAAAAAAALQRGL
VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
PGCGKVYGKTSHLKAHLRWH
TGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
CGKRFMRSDHLAKHVKTH
QNKKLKVAEAGVKREDARDL
Sequence length 398
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PROSTATIC NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Hepatoblastoma Hepatoblastoma Pubtator 34245919 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer CTD_human_DG 17013881
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Prostatic Neoplasms CTD_human_DG 17013881
★★☆☆☆
Found in Text Mining + Unknown/Other Associations