Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	388611
Gene name	CD164 molecule like 2
Gene symbol	CD164L2
Synonyms (NCBI Gene)	EAPG6122UNQ6122
Chromosome	1
Chromosome location	1p36.11

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments
MIRT873975	hsa-miR-324-5p	CLIP-seq
MIRT873976	hsa-miR-3664-3p	CLIP-seq
MIRT873977	hsa-miR-3679-3p	CLIP-seq
MIRT2196182	hsa-miR-4267	CLIP-seq
MIRT2196183	hsa-miR-4691-3p	CLIP-seq
MIRT2385727	hsa-miR-4512	CLIP-seq
MIRT2499240	hsa-miR-4707-3p	CLIP-seq
MIRT2499241	hsa-miR-4722-5p	CLIP-seq
MIRT2499242	hsa-miR-548a-3p	CLIP-seq
MIRT2499243	hsa-miR-548ae	CLIP-seq
MIRT2499244	hsa-miR-548aj	CLIP-seq
MIRT2499245	hsa-miR-548am	CLIP-seq
MIRT2499246	hsa-miR-548e	CLIP-seq
MIRT2499247	hsa-miR-548f	CLIP-seq
MIRT2499248	hsa-miR-548x	CLIP-seq
MIRT2499240	hsa-miR-4707-3p	CLIP-seq
MIRT2499241	hsa-miR-4722-5p	CLIP-seq
MIRT2499242	hsa-miR-548a-3p	CLIP-seq
MIRT2499243	hsa-miR-548ae	CLIP-seq
MIRT2499244	hsa-miR-548aj	CLIP-seq
MIRT2499245	hsa-miR-548am	CLIP-seq
MIRT2499246	hsa-miR-548e	CLIP-seq
MIRT2499247	hsa-miR-548f	CLIP-seq
MIRT2499248	hsa-miR-548x	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UWJ8

Protein name

CD164 sialomucin-like 2 protein

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05283	MGC-24	53 → 173	Multi-glycosylated core protein 24 (MGC-24), sialomucin	Family

Sequence

MEAPGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVC
EHCVEGDGARNLSSCVWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPK
TVTTGSPPVPEAHSPGFDGASFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI

Sequence length

174

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Essential Hypertension	Hypertension	BEFREE	22471352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22471352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22471352	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	22471352		★★★★★ ★☆☆☆☆ Found in Text Mining only

CD164L2 (CD164 molecule like 2)