Gene Gene information from NCBI Gene database.
Entrez ID 388585
Gene name Hes family bHLH transcription factor 5
Gene symbol HES5
Synonyms (NCBI Gene)
bHLHb38
Chromosome 1
Chromosome location 1p36.32
Summary This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the norma
miRNA miRNA information provided by mirtarbase database.
2
miRTarBase ID miRNA Experiments Reference
MIRT439161 hsa-let-7c-5p 3'LIFE 25074381
MIRT439161 hsa-let-7c-5p 3'LIFE 25074381
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
94
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607348 19764 ENSG00000197921
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TA89
Protein name Transcription factor HES-5 (Class B basic helix-loop-helix protein 38) (bHLHb38) (Hairy and enhancer of split 5)
Protein function Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 17 73 Helix-loop-helix DNA-binding domain Domain
PF07527 Hairy_orange 87 122 Hairy Orange Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal heart and brain tumors. {ECO:0000269|PubMed:15254753}.
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSK
AFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RP
PAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Sequence length 166
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Notch signaling pathway
Human papillomavirus infection
Pathways in cancer
Breast cancer
  NOTCH1 Intracellular Domain Regulates Transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Astrocytoma Astrocytoma BEFREE 17849174
★☆☆☆☆
Found in Text Mining only
Azoospermia Nonobstructive Nonobstructive azoospermia Pubtator 33602558 Associate
★☆☆☆☆
Found in Text Mining only
Benign neoplasm of brain, unspecified Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone Disease BEFREE 27463014
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms CTD_human_DG 21127729
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 20030805, 22971117, 33461604 Associate
★☆☆☆☆
Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked Bulbospinal Atrophy, X-Linked BEFREE 30940675
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 17388915 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 27420998 Stimulate
★☆☆☆☆
Found in Text Mining only