C1QTNF12 (C1q and TNF related 12)

Gene

• Entrez ID: 388581
• Gene name: C1q and TNF related 12
• Gene symbol: C1QTNF12
• Synonyms (NCBI Gene): C1QDC2, CTRP12, FAM132A
• Chromosome: 1
• Chromosome location: 1p36.33

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	IBA
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046324	Process	Regulation of D-glucose import	IEA
GO:0046324	Process	Regulation of D-glucose import	ISS
GO:0046326	Process	Positive regulation of D-glucose import	IBA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IBA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA

Other IDs

• MIM: 616593
• HGNC: 32308
• e!Ensembl: ENSG00000184163

Protein

• UniProt ID: Q5T7M4
• Protein name: Adipolin (Adipose-derived insulin-sensitizing factor) (C1q and TNF related protein 12) (Complement C1q tumor necrosis factor-related protein 12) [Cleaved into: Adipolin fC1QTNF12 (Adipolin fCTRP12) (Adipolin full-length form); Adipolin gC1QTNF12 (Adipolin
• Protein function: Insulin-sensitizing adipocyte-secreted protein (adipokine) that regulates glucose metabolism in liver and adipose tissue. Promotes glucose uptake in adipocytes and suppresses de novo glucose production in hepatocytes via the PI3K-Akt signaling p
• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed by adipose tissues. {ECO:0000269|PubMed:22275362}.
• Sequence:

  MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASSREGLPEAPKP
  SQASGPEFSDAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHE
  FQELLKEATERRFSGLLDPLLPQGAGLRLVGEAFHCRLQGPRRVDKRTLVELHGFQAPAA
  QGAFLRGSGLSLASGRFTAPVSGIFQFSASLHVDHSELQGKARLRARDVVCVLICIESLC
  QRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVDNGSGAVLTIQAGSSFSGLLL
  GT

• Sequence length: 302

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	30337217		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30337217		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29452073		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30337217		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30337217		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30337217		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22275362, 27657997		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22275362, 27657997		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27657997, 28207876		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22275362, 23068097, 24358263, 30540803		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28431867		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30540803		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30874788		★☆☆☆☆ Found in Text Mining only