INCA1 (inhibitor of CDK, cyclin A1 interacting protein 1)

Gene

• Entrez ID: 388324
• Gene name: Inhibitor of CDK, cyclin A1 interacting protein 1
• Gene symbol: INCA1
• Synonyms (NCBI Gene): HSD45
• Chromosome: 17
• Chromosome location: 17p13.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	21540187
GO:0005515	Function	Protein binding	IPI	18756329, 21540187, 21750715, 21874239, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	15159402, 18756329
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18756329
GO:0005737	Component	Cytoplasm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030332	Function	Cyclin binding	IBA
GO:0030332	Function	Cyclin binding	IDA	21540187
GO:0030332	Function	Cyclin binding	IEA
GO:0030332	Function	Cyclin binding	IPI	15159402
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0044877	Function	Protein-containing complex binding	IPI	15159402
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	21540187
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0097190	Process	Apoptotic signaling pathway	IBA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 617374
• HGNC: 32224
• e!Ensembl: ENSG00000196388

Protein

• UniProt ID: Q0VD86
• Protein name: Protein INCA1 (Inhibitor of CDK interacting with cyclin A1)
• Protein function: Binds to CDK2-bound cyclins and inhibits the kinase activity of CDK2; binding to cyclins is critical for its function as CDK inhibitor (PubMed:21540187). Inhibits cell growth and cell proliferation and may play a role in cell cycle control (By s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15142	INCA1	12 → 190	INCA1	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in testis, and at lower levels in ovary. Detected at very low levels in testis tumors (PubMed:15159402). Down-regulated in bone marrow cells in acute myeloid and lymphoid leukemia patients as compared with normal bone marrow c
• Sequence:

  MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQ
  HIPPMLRATGCSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHL
  EDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRF
  LTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE

• Sequence length: 236

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations