Gene Gene information from NCBI Gene database.
Entrez ID 388112
Gene name Nanog homeobox retrogene P8
Gene symbol NANOGP8
Synonyms (NCBI Gene)
NANOGP1PN8
Chromosome 15
Chromosome location 15q14
Summary This gene represents a transcribed retrogene of the Nanog homeobox gene. The putative encoded protein may participate in reprogramming of cancer cells. In vitro studies using a recombinant protein have shown that the protein localizes to the nucleus and c
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
621215 23106 ENSG00000255192
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NSW7
Protein name Homeobox protein NANOGP8
Protein function May act as a transcription regulator (By similarity). When overexpressed, promotes entry of cells into S phase and cell proliferation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 96 152 Homeodomain Domain
Sequence
MSVDPACPQSLPCFEESDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKR
WQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Signaling pathways regulating pluripotency of stem cells
Proteoglycans in cancer
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRONCHOPULMONARY DYSPLASIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Keratoconus Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
22q11 Deletion Syndrome 22q11 deletion syndrome BEFREE 27604636
★☆☆☆☆
Found in Text Mining only
22q11 Deletion Syndrome 22q11 deletion syndrome Pubtator 27604636 Associate
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 20427424
★☆☆☆☆
Found in Text Mining only
Cataract Cataract BEFREE 23839044
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 22079639
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 22851508, 23085761, 28453235
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 28453235 Associate
★☆☆☆☆
Found in Text Mining only
Congenital Heart Defects Congenital heart defects BEFREE 27604636
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 29787607, 32092088, 36696426 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 36696426 Stimulate
★☆☆☆☆
Found in Text Mining only