INSC (INSC spindle orientation adaptor protein)

Gene

• Entrez ID: 387755
• Gene name: INSC spindle orientation adaptor protein
• Gene symbol: INSC
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11p15.2
• Summary: In Drosophila, neuroblasts divide asymmetrically into another neuroblast at the apical side and a smaller ganglion mother cell on the basal side. Cell polarization is precisely regulated by 2 apically localized multiprotein signaling complexes that are te

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018388	hsa-miR-335-5p	Microarray	18185580
MIRT1067516	hsa-miR-1226	CLIP-seq
MIRT1067517	hsa-miR-1256	CLIP-seq
MIRT1067518	hsa-miR-1305	CLIP-seq
MIRT1067519	hsa-miR-197	CLIP-seq
MIRT1067520	hsa-miR-3689d	CLIP-seq
MIRT1067521	hsa-miR-4459	CLIP-seq
MIRT1067522	hsa-miR-4477a	CLIP-seq
MIRT1067523	hsa-miR-4705	CLIP-seq
MIRT1067524	hsa-miR-4729	CLIP-seq
MIRT1067525	hsa-miR-4733-3p	CLIP-seq
MIRT1067526	hsa-miR-4786-3p	CLIP-seq
MIRT1067527	hsa-miR-607	CLIP-seq
MIRT1067528	hsa-miR-665	CLIP-seq
MIRT2016423	hsa-miR-1257	CLIP-seq
MIRT2016424	hsa-miR-4677-3p	CLIP-seq
MIRT2016425	hsa-miR-4679	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16458856, 22074847, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IMP	22074847
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	IMP	22074847
GO:0007399	Process	Nervous system development	IEA
GO:0008093	Function	Cytoskeletal anchor activity	IBA
GO:0008356	Process	Asymmetric cell division	IEA
GO:0009786	Process	Regulation of asymmetric cell division	IBA
GO:0019904	Function	Protein domain specific binding	IPI	22074847
GO:0030154	Process	Cell differentiation	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	16458856
GO:0031647	Process	Regulation of protein stability	IDA	22074847
GO:0032991	Component	Protein-containing complex	IDA	16458856
GO:0032991	Component	Protein-containing complex	IMP	22074847
GO:0045176	Process	Apical protein localization	IBA
GO:0045179	Component	Apical cortex	IBA

Other IDs

• MIM: 610668
• HGNC: 33116
• e!Ensembl: ENSG00000188487

Protein

• UniProt ID: Q1MX18
• Protein name: Protein inscuteable homolog
• Protein function: May function as an adapter linking the Par3 complex to the GPSM1/GPSM2 complex (PubMed:16458856). Involved in spindle orientation during mitosis. May regulate cell proliferation and differentiation in the developing nervous system. May play a ro
• PDB: 3SF4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16748	INSC_LBD	70 → 116	Inscuteable LGN-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed in various tissues with stronger expression in liver, kidney and small intestine. Isoform 2 is abundantly expressed in small intestine and to a lower extent in lung and pancreas. {ECO:0000269|PubMed:12469229, ECO
• Sequence:

  MRRPPGNGEAASEGPGGWGLWGVQESRRLCCAGHDRCKQALLQIGINMMALPGGRHLDSV
  TLPGQRLHLMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPGPGDP
  LQLLLKRGWVISTELRRIGQKLAQDRWARVHSMSVRLTCHARSMVSEYSAVSRNSLKEMG
  EIEKLLMEKCSELSAVTERCLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQ
  ALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLYPQ
  ALRTLASICCVEEGVHQLEKVDGVLCLADILTDNSHSEATRAEAAAVVAQVTSPHLPVTQ
  HLSSFLESMEEIVTALVKLCQEASSGEVFLLASAALANITFFDTMACEMLLQLNAIRVLL
  EACSDKQRVDTPYTRDQIVTILANMSVLEQCASDIIQENGVQLIMGMLSEKPRSGTPAEV
  AACERVQQKAAVTLARLSRDPDVAREAVRLSCMSRLIELCRSPSERNSSDAVLVACLAAL
  RRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV

• Sequence length: 579

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	37728470	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36132082	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37728470	Inhibit	★☆☆☆☆ Found in Text Mining only