Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	387332
Gene name	TATA-box binding protein like 2
Gene symbol	TBPL2
Synonyms (NCBI Gene)	TBP2TRF3
Chromosome	14
Chromosome location	14q22.3

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT532261	hsa-miR-6800-3p	PAR-CLIP	22012620
MIRT532260	hsa-miR-1324	PAR-CLIP	22012620
MIRT532259	hsa-miR-6832-3p	PAR-CLIP	22012620
MIRT532258	hsa-miR-4469	PAR-CLIP	22012620
MIRT532257	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT532256	hsa-miR-4287	PAR-CLIP	22012620
MIRT532255	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT532254	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT532253	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT532252	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT532251	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT532250	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT532249	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT532261	hsa-miR-6800-3p	PAR-CLIP	22012620
MIRT532260	hsa-miR-1324	PAR-CLIP	22012620
MIRT532259	hsa-miR-6832-3p	PAR-CLIP	22012620
MIRT532258	hsa-miR-4469	PAR-CLIP	22012620
MIRT532257	hsa-miR-7113-3p	PAR-CLIP	22012620
MIRT532256	hsa-miR-4287	PAR-CLIP	22012620
MIRT532255	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT532254	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT532253	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT532252	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT532251	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT532250	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT532249	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT2346751	hsa-miR-378g	CLIP-seq
MIRT2346752	hsa-miR-4652-3p	CLIP-seq
MIRT2346753	hsa-miR-4731-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001674	Component	Female germ cell nucleus	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IDA	14634207
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	14634207
GO:0005737	Component	Cytoplasm	IEA
GO:0006352	Process	DNA-templated transcription initiation	IBA
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA

MIM	HGNC	e!Ensembl
608964	19841	ENSG00000182521

Q6SJ96

Protein name

TATA box-binding protein-like 2 (TBP-like 2) (TATA box-binding protein-related factor 3) (TBP-related factor 3)

Protein function

Transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process (By similarity). {ECO:0000250|UniProtKB:Q6SJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00352	TBP	199 → 281	Transcription factor TFIID (or TATA-binding protein, TBP)	Domain
PF00352	TBP	289 → 372	Transcription factor TFIID (or TATA-binding protein, TBP)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes. {ECO:0000269|PubMed:14634207, ECO:0000269|PubMed:17570761}.

Sequence

MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPL
FSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHE
TEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSL
ASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMR
IREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCD
VRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYE
AFENIYPILKGFKKA

Sequence length

375

Interactions

View interactions

	KEGG
	Basal transcription factors Huntington disease Spinocerebellar ataxia Human papillomavirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	14983878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17115886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17115886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29854083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12189205	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17115886, 29854083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17115886, 29854083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20172870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20172870, 33572677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	24130091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12189205	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	18974273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	37804378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	37804378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14983878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19351825, 21964212, 29854083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19351825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20435060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23172669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19932085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37804378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	27642674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	27642674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14983878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24130091		★★★★★ ★☆☆☆☆ Found in Text Mining only

TBPL2 (TATA-box binding protein like 2)