NPSR1 (neuropeptide S receptor 1)

Gene

• Entrez ID: 387129
• Gene name: Neuropeptide S receptor 1
• Gene symbol: NPSR1
• Synonyms (NCBI Gene): ASRT2, GPR154, GPRA, NPSR, PGR14, VRR1
• Chromosome: 7
• Chromosome location: 7p14.3
• Summary: This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1191311	hsa-miR-1343	CLIP-seq
MIRT1191312	hsa-miR-2110	CLIP-seq
MIRT1191313	hsa-miR-3064-5p	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT1191315	hsa-miR-3652	CLIP-seq
MIRT1191316	hsa-miR-3667-3p	CLIP-seq
MIRT1191317	hsa-miR-4271	CLIP-seq
MIRT1191318	hsa-miR-4430	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191320	hsa-miR-4476	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT1191327	hsa-miR-4725-3p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191329	hsa-miR-4790-3p	CLIP-seq
MIRT1191330	hsa-miR-491-5p	CLIP-seq
MIRT1191331	hsa-miR-541	CLIP-seq
MIRT1191332	hsa-miR-654-5p	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191334	hsa-miR-1253	CLIP-seq
MIRT1191335	hsa-miR-3918	CLIP-seq
MIRT1191336	hsa-miR-4269	CLIP-seq
MIRT1191337	hsa-miR-4645-5p	CLIP-seq
MIRT1191338	hsa-miR-4673	CLIP-seq
MIRT1191339	hsa-miR-4733-3p	CLIP-seq
MIRT1191340	hsa-miR-4795-5p	CLIP-seq
MIRT2284398	hsa-miR-4504	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RORA	Repression	23565190

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005737	Component	Cytoplasm	IDA	15947423
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15947423, 16790440
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15947423
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IDA	16790440
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IBA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	16790440
GO:0060013	Process	Righting reflex	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903999	Process	Negative regulation of eating behavior	IEA
GO:2000293	Process	Negative regulation of defecation	IEA

Other IDs

• MIM: 608595
• HGNC: 23631
• e!Ensembl: ENSG00000187258

Protein

• UniProt ID: Q6W5P4
• Protein name: Neuropeptide S receptor (G-protein coupled receptor 154) (G-protein coupled receptor PGR14) (G-protein coupled receptor for asthma susceptibility)
• Protein function: G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca(2+) stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 330	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in
• Sequence:

  MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
  VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
  CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
  TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
  SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
  LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
  EMQILSKPEFI

• Sequence length: 371

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma-related traits, susceptibility to, 2	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Agoraphobia	Agoraphobia	BEFREE	31734525		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23663310		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	15710598		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	19732772, 20179762, 21525857, 22216302, 24331455, 24800784, 25971599, 27176146, 27990720, 31734525, 32321595	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20179762, 20705147, 21525857, 22404660, 23103692, 23319044, 23325374, 23466585, 24331455, 25091462, 25788677, 26235955, 26503268, 26575296, 27176146, 27883964, 27990720, 29055857, 31132388		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20179762, 20705147, 21525857, 22404660, 23103692, 23319044, 23325374, 23466585, 24331455, 25091462, 25788677, 25971599, 26235955, 26503268, 26575296, 27176146, 27883964, 27990720, 29055857, 31132388		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	21525857, 24331455, 25971599	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20179762, 22216302	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15073379, 15683615, 15710598, 15764725, 15947423, 16096103, 16522461, 16790440, 16829631, 16926187, 16938805, 17210045, 17702965, 17854592, 18285428, 18305139, 18340359, 19325992, 19614867, 19624525, 19732772, 19996348, 20179762, 20705147, 21707994, 23372674, 23565190, 23663310, 24439655, 25091462, 25150870, 27176146, 28463995, 28660189, 30532529, 30711025, 30927345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15073379, 15710598, 15764725, 15941840, 15947423, 16522461, 16790440, 16926187, 17210045, 17702965, 18305139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	15710598, 15764725, 16926187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16790440, 17702965, 18305139, 19247692, 19325992, 19732772, 19951440, 20179762, 21707994, 22216302, 23372674, 23663310, 24253534, 24386135, 28463995, 30532529	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	17669576, 23325374		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22675514		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	15764725		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	LHGDN	15941840		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	16938805, 22675514		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	18340359, 23565190		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	20179762	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29983891		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27990720		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17854592		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	20171785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	24331455	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27176146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	18305139	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24260339, 24439655		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	24331455	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19325992		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	24260339	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	30532529	Associate	★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	19732772		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19732772, 22216302	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27990720		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27990720	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31132388		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31132388		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17854592, 19614867, 19732772, 20179762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19732772, 20179762, 22216302, 24386135	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal Diseases	BEFREE	19614867		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16829631, 17127271		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29983891		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	20171785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27176146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26680586		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	28228241		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33332443	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	23680103		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25945796	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	17669576, 20603625, 20628342, 20705147, 21525857, 23680103, 24331455, 26390831, 26503268, 26575296, 27883964, 31734525		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	21525857, 22078257, 22216302, 23680103, 24331455, 25971599, 31734525	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31734525	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31291233		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16096103		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24253534	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30532529		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	16938805		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	16938805		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	16938805		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20179762, 22548958, 30711025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	23663310	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17669576, 22078257, 23680103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17669576, 22078257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22078257, 23680103	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short Sleeper Syndrome	Short Sleeper Syndromes	BEFREE	31619542		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35030041	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17854592, 29983891		★☆☆☆☆ Found in Text Mining only