SUMO4 (small ubiquitin like modifier 4)

Gene

• Entrez ID: 387082
• Gene name: Small ubiquitin like modifier 4
• Gene symbol: SUMO4
• Synonyms (NCBI Gene): IDDM5, SMT3H4, SUMO-4, dJ281H8.4
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins` subcellular localization, stability, or activity. The protein described in this rec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403357	hsa-miR-2053	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403360	hsa-miR-28-3p	CLIP-seq
MIRT1403361	hsa-miR-3123	CLIP-seq
MIRT1403362	hsa-miR-3925-5p	CLIP-seq
MIRT1403363	hsa-miR-3976	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403367	hsa-miR-548p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT2342879	hsa-miR-1299	CLIP-seq
MIRT2342880	hsa-miR-1323	CLIP-seq
MIRT1403356	hsa-miR-186	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT2342881	hsa-miR-2964a-5p	CLIP-seq
MIRT2342882	hsa-miR-3133	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT2342883	hsa-miR-4263	CLIP-seq
MIRT2342884	hsa-miR-4328	CLIP-seq
MIRT2342885	hsa-miR-4436b-5p	CLIP-seq
MIRT2342886	hsa-miR-4446-5p	CLIP-seq
MIRT2342887	hsa-miR-4461	CLIP-seq
MIRT2342888	hsa-miR-4705	CLIP-seq
MIRT2342889	hsa-miR-4735-5p	CLIP-seq
MIRT2342890	hsa-miR-4773	CLIP-seq
MIRT2342891	hsa-miR-4782-5p	CLIP-seq
MIRT2120869	hsa-miR-4793-5p	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq
MIRT2342892	hsa-miR-516b	CLIP-seq
MIRT2342893	hsa-miR-548o	CLIP-seq
MIRT2342894	hsa-miR-576-5p	CLIP-seq
MIRT1403355	hsa-miR-1261	CLIP-seq
MIRT1403358	hsa-miR-27a	CLIP-seq
MIRT1403359	hsa-miR-27b	CLIP-seq
MIRT1403364	hsa-miR-4252	CLIP-seq
MIRT1403365	hsa-miR-5096	CLIP-seq
MIRT1403366	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	15247916, 16236267, 18708028
GO:0016925	Process	Protein sumoylation	IEA
GO:0031386	Function	Protein tag activity	IBA
GO:0034599	Process	Cellular response to oxidative stress	IDA	16236267, 18708028
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IDA	15247916, 18708028
GO:0043388	Process	Positive regulation of DNA binding	IDA	16236267
GO:0043392	Process	Negative regulation of DNA binding	IDA	16236267
GO:0044389	Function	Ubiquitin-like protein ligase binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15247916, 16236267
GO:0106068	Component	SUMO ligase complex	IDA	16236267
GO:1900180	Process	Regulation of protein localization to nucleus	IDA	16236267
GO:1900180	Process	Regulation of protein localization to nucleus	IEA

Other IDs

• MIM: 608829
• HGNC: 21181
• e!Ensembl: ENSG00000177688

Protein

• UniProt ID: Q6EEV6
• Protein name: Small ubiquitin-related modifier 4 (SUMO-4) (Small ubiquitin-like protein 4)
• Protein function: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugat
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11976	Rad60-SLD	18 → 88	Ubiquitin-2 like Rad60 SUMO-like	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916}.
• Sequence:

  MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRF
  RFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

• Sequence length: 95

Pathways

KEGG:

Nucleocytoplasmic transport
Fluid shear stress and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES DUE TO AUTOIMMUNE PROCESS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES DUE TO IMMUNE MEDIATED PANCREATIC ISLET BETA-CELL DESTRUCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 5	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, KETOSIS-PRONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS 5	—	CTD, ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Addison Disease	Addison`s Disease	BEFREE	15730420		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16735488		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35503374	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11145035	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11145035, 16249223, 16384851, 16735488, 16821265, 17374705, 18657476, 19956095, 21901353		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11145035, 16249223, 19956095	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16735488		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18657476, 20868570, 21901353, 31669406		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	18657476		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15123604	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19410319		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19410319		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19410319		★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	35503374	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19997558, 20728233, 27055882		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19997558, 20728233, 27055882, 28689037		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10762555, 11145035, 11204251, 15123604, 19956095	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11145035, 11204251, 15123604, 15247916, 15729364, 15730420, 16159953, 16306380, 16735488, 16821265, 17130530, 17130532, 17130563, 17130565, 17373940, 17374705, 17448564, 17452059, 17554341, 17926234, 17990297, 19410319, 19956095, 19956109, 21158221, 22069273, 22423385, 22884980, 22936652, 28197920, 8817350, 8981961, 9239508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	17130563		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 5	Diabetes Mellitus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 5	Diabetes Mellitus	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17229939, 17374705, 19410319, 19915388, 20728233, 22936652, 25189908, 27055882, 28494838, 28689037		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	17130565, 17373940, 17558709		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17229939, 19410319, 27055882		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17229939, 17660269		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17926234		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	17926234		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	28545138		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	15730420		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15730420		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28545138	Stimulate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	16159953		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27055882		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	17130565		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15123604		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16249223		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	16249223		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19997558		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18330586		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	18330586		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16159953, 16735488, 16755651, 16821265		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20868570, 21901353		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31669406		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	19122825		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	19122825	Associate	★☆☆☆☆ Found in Text Mining only