KRT15 (keratin 15)

Gene

• Entrez ID: 3866
• Gene name: Keratin 15
• Gene symbol: KRT15
• Synonyms (NCBI Gene): CK15, K15, K1CO
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043849	hsa-miR-340-3p	CLASH	23622248
MIRT1101143	hsa-miR-3941	CLIP-seq
MIRT1101144	hsa-miR-466	CLIP-seq
MIRT1101145	hsa-miR-4672	CLIP-seq
MIRT1101146	hsa-miR-4731-3p	CLIP-seq
MIRT1101147	hsa-miR-4801	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT1101149	hsa-miR-556-5p	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT2258835	hsa-miR-1207-5p	CLIP-seq
MIRT2258836	hsa-miR-3150a-3p	CLIP-seq
MIRT2258837	hsa-miR-3175	CLIP-seq
MIRT2258838	hsa-miR-3199	CLIP-seq
MIRT2258839	hsa-miR-3714	CLIP-seq
MIRT2258840	hsa-miR-3921	CLIP-seq
MIRT1101143	hsa-miR-3941	CLIP-seq
MIRT2258841	hsa-miR-4481	CLIP-seq
MIRT2258842	hsa-miR-4493	CLIP-seq
MIRT2258843	hsa-miR-4502	CLIP-seq
MIRT2258844	hsa-miR-4653-5p	CLIP-seq
MIRT1101144	hsa-miR-466	CLIP-seq
MIRT1101145	hsa-miR-4672	CLIP-seq
MIRT2258845	hsa-miR-4693-3p	CLIP-seq
MIRT2258846	hsa-miR-4712-3p	CLIP-seq
MIRT1101146	hsa-miR-4731-3p	CLIP-seq
MIRT2258847	hsa-miR-4745-5p	CLIP-seq
MIRT2258848	hsa-miR-4763-3p	CLIP-seq
MIRT1101147	hsa-miR-4801	CLIP-seq
MIRT2258849	hsa-miR-491-5p	CLIP-seq
MIRT1101148	hsa-miR-502-5p	CLIP-seq
MIRT1101149	hsa-miR-556-5p	CLIP-seq
MIRT2258850	hsa-miR-939	CLIP-seq
MIRT2258851	hsa-miR-940	CLIP-seq
MIRT2258835	hsa-miR-1207-5p	CLIP-seq
MIRT2258838	hsa-miR-3199	CLIP-seq
MIRT2258839	hsa-miR-3714	CLIP-seq
MIRT2258842	hsa-miR-4493	CLIP-seq
MIRT2390031	hsa-miR-4515	CLIP-seq
MIRT2390032	hsa-miR-4653-3p	CLIP-seq
MIRT2258848	hsa-miR-4763-3p	CLIP-seq
MIRT2258851	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXM1	Unknown	22761689

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002009	Process	Morphogenesis of an epithelium	IBA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	2580298
GO:0005515	Function	Protein binding	IPI	16189514, 22458338, 24940650, 25416956, 25910212, 26871637, 27812135, 29892012, 31515488, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005882	Component	Intermediate filament	IEA
GO:0005882	Component	Intermediate filament	TAS	2580298
GO:0008544	Process	Epidermis development	TAS	2452170
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0030855	Process	Epithelial cell differentiation	IBA
GO:0045095	Component	Keratin filament	IBA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0097110	Function	Scaffold protein binding	IPI	10852826

Other IDs

• MIM: 148030
• HGNC: 6421
• e!Ensembl: ENSG00000171346

Protein

• UniProt ID: P19012
• Protein name: Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00038	Filament	104 → 416	Intermediate filament protein	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a discontinuous manner in the basal cell layer of adult skin epidermis, but continuously in the basal layer of fetal skin epidermis and nail. Also expressed in the outer root sheath above the hair bulb in hair follicle (at
• Sequence:

  MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGY
  GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
  DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
  IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
  KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
  TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
  LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
  AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

• Sequence length: 456

Pathways

KEGG:

Estrogen signaling pathway
Staphylococcus aureus infection

Reactome:

Keratinization
Formation of the cornified envelope

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	29805107, 31809668		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29805107		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	26076064		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	31774585		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	26076064		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35328735	Associate	★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18789069		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29285211		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19383306		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19383306, 21574054	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19383306, 24260555		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29135512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28258914	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36858509	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12946229, 31809668	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24260555		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	11752170	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21866211, 24255036, 25446319, 26788028	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	25760270	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	25760270	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35866777	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	35304249	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27797221	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27797221	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	11876765		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	11876765	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22469882		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25948739	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	29805107		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23028325, 28938025		★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar, Epidermolytic	Epidermolytic palmoplantar keratoderma	BEFREE	27864007		★☆☆☆☆ Found in Text Mining only
Lichen planus follicularis	Lichen planopilaris	BEFREE	31774585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30718100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24260555		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19524636		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29460532		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32934956, 33441834	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32934956	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19383306, 28938025, 29805107, 9288774		★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	27153399		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19383306		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	22431489		★☆☆☆☆ Found in Text Mining only
Papilloma, Squamous Cell	Papilloma	BEFREE	22431489		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	20190734, 23398472	Associate	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	11876765	Associate	★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	BEFREE	19162247		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Kaposi	Sarcoma	Pubtator	25948739, 28938025, 29795033	Associate	★☆☆☆☆ Found in Text Mining only
Scarring alopecia	Alopecia	BEFREE	19162247		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	22431489		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31189369		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30718100		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12778082	Associate	★☆☆☆☆ Found in Text Mining only