KRT7 (keratin 7)

Gene

• Entrez ID: 3855
• Gene name: Keratin 7
• Gene symbol: KRT7
• Synonyms (NCBI Gene): CK7, K2C7, K7, SCL
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified ep

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000331	hsa-miR-133a-3p	Review	20026422
MIRT003324	hsa-miR-199a-3p	Review	20026422
MIRT004939	hsa-miR-30a-3p	Immunoblot, qRT-PCR	19378336
MIRT000331	hsa-miR-133a-3p	Immunoblot, qRT-PCR	19378336
MIRT003324	hsa-miR-199a-3p	Immunoblot, qRT-PCR	19378336
MIRT004938	hsa-miR-145-5p	Immunoblot, qRT-PCR	19378336
MIRT004937	hsa-miR-195-5p	Immunoblot, qRT-PCR	19378336
MIRT004936	hsa-miR-125b-5p	Immunoblot, qRT-PCR	19378336
MIRT025743	hsa-miR-7-5p	Microarray	19073608
MIRT1101438	hsa-miR-1207-5p	CLIP-seq
MIRT1101439	hsa-miR-1827	CLIP-seq
MIRT1101440	hsa-miR-1909	CLIP-seq
MIRT1101441	hsa-miR-3612	CLIP-seq
MIRT1101442	hsa-miR-3622b-5p	CLIP-seq
MIRT1101443	hsa-miR-3689a-3p	CLIP-seq
MIRT1101444	hsa-miR-3689c	CLIP-seq
MIRT1101445	hsa-miR-4645-5p	CLIP-seq
MIRT1101446	hsa-miR-4651	CLIP-seq
MIRT1101447	hsa-miR-4673	CLIP-seq
MIRT1101448	hsa-miR-4728-5p	CLIP-seq
MIRT1101449	hsa-miR-4763-3p	CLIP-seq
MIRT1101450	hsa-miR-608	CLIP-seq
MIRT1101451	hsa-miR-650	CLIP-seq
MIRT1101452	hsa-miR-940	CLIP-seq
MIRT1101438	hsa-miR-1207-5p	CLIP-seq
MIRT2258903	hsa-miR-1208	CLIP-seq
MIRT2258904	hsa-miR-122	CLIP-seq
MIRT2258905	hsa-miR-1293	CLIP-seq
MIRT2258906	hsa-miR-1302	CLIP-seq
MIRT1101439	hsa-miR-1827	CLIP-seq
MIRT1101440	hsa-miR-1909	CLIP-seq
MIRT2258907	hsa-miR-1972	CLIP-seq
MIRT2258908	hsa-miR-219-5p	CLIP-seq
MIRT2258909	hsa-miR-2467-5p	CLIP-seq
MIRT2258910	hsa-miR-3122	CLIP-seq
MIRT2258911	hsa-miR-3135b	CLIP-seq
MIRT2258912	hsa-miR-3180-5p	CLIP-seq
MIRT2258913	hsa-miR-3188	CLIP-seq
MIRT1101441	hsa-miR-3612	CLIP-seq
MIRT1101442	hsa-miR-3622b-5p	CLIP-seq
MIRT2258914	hsa-miR-3649	CLIP-seq
MIRT2258915	hsa-miR-3652	CLIP-seq
MIRT1101443	hsa-miR-3689a-3p	CLIP-seq
MIRT1101444	hsa-miR-3689c	CLIP-seq
MIRT2258916	hsa-miR-3913-5p	CLIP-seq
MIRT2258917	hsa-miR-3975	CLIP-seq
MIRT2258918	hsa-miR-4265	CLIP-seq
MIRT2258919	hsa-miR-4296	CLIP-seq
MIRT2258920	hsa-miR-4298	CLIP-seq
MIRT2258921	hsa-miR-431	CLIP-seq
MIRT2258922	hsa-miR-4322	CLIP-seq
MIRT2258923	hsa-miR-4430	CLIP-seq
MIRT2258924	hsa-miR-4445	CLIP-seq
MIRT2258925	hsa-miR-4483	CLIP-seq
MIRT2258926	hsa-miR-4494	CLIP-seq
MIRT2258927	hsa-miR-4505	CLIP-seq
MIRT1101445	hsa-miR-4645-5p	CLIP-seq
MIRT2258928	hsa-miR-4650-5p	CLIP-seq
MIRT1101446	hsa-miR-4651	CLIP-seq
MIRT1101447	hsa-miR-4673	CLIP-seq
MIRT1101448	hsa-miR-4728-5p	CLIP-seq
MIRT1101449	hsa-miR-4763-3p	CLIP-seq
MIRT2258929	hsa-miR-4778-3p	CLIP-seq
MIRT2258930	hsa-miR-4778-5p	CLIP-seq
MIRT2258931	hsa-miR-4782-3p	CLIP-seq
MIRT2258932	hsa-miR-485-5p	CLIP-seq
MIRT2258933	hsa-miR-508-3p	CLIP-seq
MIRT2258934	hsa-miR-510	CLIP-seq
MIRT2258935	hsa-miR-520a-5p	CLIP-seq
MIRT2258936	hsa-miR-525-5p	CLIP-seq
MIRT2258937	hsa-miR-541	CLIP-seq
MIRT2258938	hsa-miR-578	CLIP-seq
MIRT2258939	hsa-miR-581	CLIP-seq
MIRT1101450	hsa-miR-608	CLIP-seq
MIRT2258940	hsa-miR-635	CLIP-seq
MIRT1101451	hsa-miR-650	CLIP-seq
MIRT2258941	hsa-miR-654-5p	CLIP-seq
MIRT2258942	hsa-miR-671-5p	CLIP-seq
MIRT2258943	hsa-miR-765	CLIP-seq
MIRT1101452	hsa-miR-940	CLIP-seq
MIRT2258903	hsa-miR-1208	CLIP-seq
MIRT2258906	hsa-miR-1302	CLIP-seq
MIRT1101439	hsa-miR-1827	CLIP-seq
MIRT2258910	hsa-miR-3122	CLIP-seq
MIRT1101441	hsa-miR-3612	CLIP-seq
MIRT1101442	hsa-miR-3622b-5p	CLIP-seq
MIRT2258914	hsa-miR-3649	CLIP-seq
MIRT1101443	hsa-miR-3689a-3p	CLIP-seq
MIRT1101444	hsa-miR-3689c	CLIP-seq
MIRT2258916	hsa-miR-3913-5p	CLIP-seq
MIRT2258920	hsa-miR-4298	CLIP-seq
MIRT2258921	hsa-miR-431	CLIP-seq
MIRT1101445	hsa-miR-4645-5p	CLIP-seq
MIRT1101447	hsa-miR-4673	CLIP-seq
MIRT1101448	hsa-miR-4728-5p	CLIP-seq
MIRT2258940	hsa-miR-635	CLIP-seq
MIRT1101451	hsa-miR-650	CLIP-seq
MIRT1101452	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXA1	Activation	20043065
TAL1	Unknown	20140202

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11169732, 21149639, 29721183, 31694235, 32867128
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IDA	2459129
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0005882	Component	Intermediate filament	NAS	2415537
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0031424	Process	Keratinization	IBA
GO:0045095	Component	Keratin filament	IBA
GO:0045095	Component	Keratin filament	IEA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 148059
• HGNC: 6445
• e!Ensembl: ENSG00000135480

Protein

• UniProt ID: P08729
• Protein name: Keratin, type II cytoskeletal 7 (Cytokeratin-7) (CK-7) (Keratin-7) (K7) (Sarcolectin) (Type-II keratin Kb7)
• Protein function: Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
• PDB: 4XIF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16208	Keratin_2_head	48 → 87	Keratin type II head	Family
  PF00038	Filament	90 → 402	Intermediate filament protein	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus. {ECO:0000
• Sequence:

  MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
  AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE
  TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
  EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI
  SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
  LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
  LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
  GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

• Sequence length: 469

Pathways

Reactome:

Keratinization
Formation of the cornified envelope

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10688671, 1756722, 30185409		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12580964, 7579412		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	11390401, 1311214, 14513050, 2467296, 2602361, 28179281		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14631371, 15489654, 15894926, 18317225		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24029707, 24324581, 24775604, 28693143, 30443294, 30832497, 31646818		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11141476		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25117316, 25175030, 26306784, 26603857, 29415661, 30539871		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	31105427		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16133982, 31593035		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18602664		★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	11141476		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	7579412		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	7672800, 9931488		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	28167838, 30546323		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	21577319	Associate	★☆☆☆☆ Found in Text Mining only
Alpha-Methylacyl-CoA Racemase Deficiency	Alpha-Methylacyl-CoA Racemase Deficiency	BEFREE	29966830		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16133982		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31747876		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29303699		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	29235037	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33253861	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	28948079, 29455021, 29879886, 30062717		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10483055, 10994648, 17210818, 1827639, 20064128, 27807927, 28328110, 28606893, 28707502, 28712415, 29045499, 29057552, 29246564, 29344846, 29434563, 29546787, 29621675, 29902667, 29908386, 29922611, 30127753, 30546323, 30689871, 31043102, 31254963, 31378654, 31400561, 31543838, 31665694		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10483055, 10994648, 17210818, 1827639, 20064128, 27807927, 28328110, 28606893, 28707502, 28712415, 29045499, 29057552, 29246564, 29344846, 29434563, 29546787, 29621675, 29902667, 29908386, 29922611, 30127753, 30546323, 30689871, 31043102, 31254963, 31378654, 31400561, 31543838, 31665694		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	11328281		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10607488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	25918132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy	Atrophy	Pubtator	34246230	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29362929, 29475216		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31275179		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31275179		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11857318, 14631367, 19578614, 24705000, 33495575	Associate	★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	27665376		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	21681009	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28852838		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30358741, 34392560, 36123893	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	21681009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	21681009		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	10923083, 16439986	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16265353, 19378336, 28024950, 29556633		★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	10705400	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32747898	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15703829, 31718619		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31718619, 31912104, 32114594, 35390310	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	28948079, 29455021, 29879886, 31695652		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	26090004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16101125, 26876208, 28212672	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	20640606	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10884806, 16133982, 17426052		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16101125, 25755810	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	22623086, 37660928	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18065959, 22260386, 29135512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	25851713	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12717831, 14556657, 16439986, 19686584, 29778232, 30588199, 31664520, 32788505	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31567946	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	20614291, 26575266, 34247629	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16265353, 19378336, 28024950		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24324581, 28827446		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35031063	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31926587, 33253861, 39682758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16415791, 17683191, 18788852, 27031776, 28449664, 28638113, 33036062, 33616415, 33990704, 34800526, 34801057, 35276058, 35980471, 36096829, 36510186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26339402	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	33963925	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	1372155, 16415794, 20614292, 23106579, 28212672, 32843061, 35345360, 36136898	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	1690512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29928353		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	22382985, 9872659		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29303699		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30138228		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30504376		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	7579412		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20503460	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28922444, 31567946	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29599000		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30588199	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	31851426		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	25046437	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	20818342, 21681009, 26101189, 34312700, 36324070	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28958913, 31335486		★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	38607191	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	31236330		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28537673		★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	BEFREE	26457355, 28705707, 30037497		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30156770, 30444288		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	19154479, 19390420		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	17606426, 22268990	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10506443, 15605076, 22268990, 23469219, 28155971, 28537673	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22361037, 28693143, 29637921		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17922593, 18587323, 21076463, 22268990, 29637921, 31474758, 34504224, 36351995, 36564440, 37164671, 39333321	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	28693143		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28852838		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1402676		★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	BEFREE	28626162		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16512599, 18478571, 25357116, 30444288, 31266596		★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy Posterior Polymorphous 1	Posterior polymorphous corneal dystrophy	Pubtator	29499165	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	36579659	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33963925	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	27418012		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15842033, 17210818, 20064128, 20494447, 21531467, 21835094, 27807927, 28028732, 28328110, 28606893, 28707502, 29045499, 29092782, 29111383, 29179911, 29220120, 29246564, 2934456, 29434563, 29546787, 29621675, 29902667, 29908386, 30127753, 30472336, 30689871, 30791342, 30961347, 31043102, 31254963, 31354542, 31434343, 31463614, 31665694		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28403359	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28659632		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	15629008	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Behavior Disorder	Disruptive Behavior Disorder	BEFREE	28456023		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	28558358		★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	31043102		★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	29776354		★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	27718331		★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	28646788		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	23775054, 28456023, 29179911, 29626825, 29846016, 29879886, 30977532, 31695652, 3346203		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	39201770	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34414815, 39201770	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28836553		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29928353		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29455021		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20043065		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20043065		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	14631371	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28958913		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28481834		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21574103, 37142981	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29353492		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29384872, 30345782		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	1690512, 37349623	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	20191116	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29048728	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20818342	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	23271126		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	10360508		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	10360508		★☆☆☆☆ Found in Text Mining only
Hepatic Adenomas Familial	Hepatic adenoma	Pubtator	18602664	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	21281815	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16570563	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory Neuropathies	Hereditary motor and sensory neuropathy	BEFREE	22329956		★☆☆☆☆ Found in Text Mining only
HIP DYSPLASIA, BEUKES TYPE	Hip Dysplasia	BEFREE	27991910		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17210818, 17481592, 24374998		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	CTD_human_DG	16927643		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	25357116, 28315424, 30156770		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	39909126	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28553720		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30689871		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36564440	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24428240		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11857318, 16951671	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29513894		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30444288		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34802045	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30548357		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10498694, 1375001, 7579412, 8035609, 8414511, 8673726, 9230693		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7579412, 8035609, 9031072		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11243382, 1964581		★☆☆☆☆ Found in Text Mining only
Limbal stem cell deficiency	Limbal stem cell deficiency	BEFREE	21693612		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16879391		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27653235, 27827952, 29778232, 30200114, 30410370		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21681009, 26101189, 36324070	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	30565271	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26101189	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17922593	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16570563, 23106579, 28827446, 30024911, 31983097	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11419977, 27827952, 28155971, 28827446, 31983097	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34628880	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35529254	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	8547631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15703829, 30024911, 31718619		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20043065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24324581, 28827446, 30718697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31317696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16265353, 19378336, 28024950		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11243382, 1387813, 22334400, 26876208, 28024950, 29643827, 31317696, 9171354		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31718619		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	1625484		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15842033, 17210818, 20064128, 20494447, 21531467, 21835094, 27807927, 28028732, 28328110, 28606893, 28707502, 29045499, 29092782, 29111383, 29179911, 29220120, 29246564, 2934456, 29434563, 29546787, 29621675, 29902667, 29908386, 30127753, 30472336, 30689871, 30791342, 30961347, 31043102, 31254963, 31354542, 31434343, 31463614, 31665694		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24428240, 29186861, 29246564, 30065872		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	24428240		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	16415794	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25400801	Stimulate	★☆☆☆☆ Found in Text Mining only
Mild depression	Mental Depression	BEFREE	2934456		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	10994648, 29100973, 29714082, 29776354, 29846016		★☆☆☆☆ Found in Text Mining only
Multiple fibrofolliculomas	Multiple Fibrofolliculomas	BEFREE	27991910		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	14513050		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1625484		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31018977, 7579412		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11141476, 11243382, 15747102, 15940270, 15994935, 1625484, 16271962, 17124599, 18381932, 19378336, 19921857, 21927821, 22361037, 23928991, 25117316, 25627346, 26306784, 28082347, 28214199, 28441375, 28463910, 29145864, 29778232, 30037497, 30194170, 30200114, 30444288, 31444626, 31686913, 31718619		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30449229		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30913089		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	24374998, 28648138		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26057535		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30472336, 31665694		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27919438	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28506319, 9118359		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	17481592		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	28885070, 30689871		★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	31681713		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	19601945, 30252696, 31720992		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21076463, 31912104	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18317225		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10506443, 1690512, 23368871, 30024911, 30287916, 34070214, 36178284, 37023314, 7678716	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35390310	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	CTD_human_DG	16927643		★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	25357116, 28315424, 30156770		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	19601945, 30252696, 31720992		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19124560		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	1372155, 16362976, 24018598, 35974300, 36906533, 37815881	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	20191116	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	28345374, 28551488		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28167838, 28551488		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	21074210, 23434146		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	39712018	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29100973, 30017779		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	30017779		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	10994648, 24374998, 28551488, 29922611, 30017779, 30472336		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	24377512		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28834884, 28871848, 30220982, 30791342		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	9171354		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10688671, 11243382, 12531481, 1311214, 1382561, 1402676, 1450410, 15198727, 1625484, 16621969, 17429429, 1922059, 20855495, 23698277, 23857984, 28028313, 29654272, 7672800, 7744799, 7824274, 7833471, 8167548, 8673726, 9171354, 9416841		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	21681009		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	14513050		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	1690512, 20699414	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20699414		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30713334		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30472336, 31665694		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15502805, 18478571, 18604734		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16512599, 17124599, 21074210, 25031714, 25357116, 26457355, 30156770, 31266596		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	14976534	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	LHGDN	17593078		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	1704194	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23988776, 31686913		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	1704194, 24131748	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	12907368		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329, 16927643		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14693349		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	10607488		★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	21681009		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	17425380	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31161851, 31215484	Associate	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	1689541	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17593078, 18949396		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20043065, 31230705		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29788741		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27036044, 29235037	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28082347		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	18624760, 24377512, 26902922, 27907906, 30738056		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31317696		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	22268990	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11857318, 14631367, 16101125, 22268990	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26876208	Stimulate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28761985		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10607488, 9543562		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29019477		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	30359635		★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	17429429		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30924920	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24832166	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	25851713	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18092953		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11254222, 11419977, 16265353, 29556633	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38321777	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	28212672, 35345360	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35295009	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28212672, 32843061, 35345360	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25144715, 35628423	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30017593		★☆☆☆☆ Found in Text Mining only
Waisman syndrome	Waisman syndrome	BEFREE	26062705		★☆☆☆☆ Found in Text Mining only