ARG2 (arginase 2)

Gene

• Entrez ID: 384
• Gene name: Arginase 2
• Gene symbol: ARG2
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q24.1
• Summary: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT032015	hsa-miR-16-5p	Microarray	21199864
MIRT279714	hsa-let-7a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26989813
MIRT279714	hsa-let-7a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26989813
MIRT793393	hsa-miR-759	CLIP-seq
MIRT2173978	hsa-miR-186	CLIP-seq
MIRT2173979	hsa-miR-188-5p	CLIP-seq
MIRT2173980	hsa-miR-2277-3p	CLIP-seq
MIRT2173981	hsa-miR-3133	CLIP-seq
MIRT2173982	hsa-miR-4744	CLIP-seq
MIRT2173983	hsa-miR-542-3p	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443869	hsa-miR-1912	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2443892	hsa-miR-664	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2477590	hsa-miR-548ag	CLIP-seq
MIRT2477591	hsa-miR-548ai	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2477592	hsa-miR-617	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2477590	hsa-miR-548ag	CLIP-seq
MIRT2477591	hsa-miR-548ai	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2477592	hsa-miR-617	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	20711410

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000050	Process	Urea cycle	IBA
GO:0000050	Process	Urea cycle	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0004053	Function	Arginase activity	IBA
GO:0004053	Function	Arginase activity	IEA
GO:0004053	Function	Arginase activity	IMP	16128822
GO:0004053	Function	Arginase activity	TAS	9144563
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	8898077
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006525	Process	Arginine metabolic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	8898077
GO:0006941	Process	Striated muscle contraction	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016813	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines	IEA
GO:0030145	Function	Manganese ion binding	IBA
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032696	Process	Negative regulation of interleukin-13 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	28614294
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0071641	Process	Negative regulation of macrophage inflammatory protein 1 alpha production	IEA
GO:0071644	Process	Negative regulation of chemokine (C-C motif) ligand 4 production	IEA
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	IEA
GO:1900425	Process	Negative regulation of defense response to bacterium	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA
GO:1905403	Process	Negative regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IEA
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IDA	22928666

Other IDs

• MIM: 107830
• HGNC: 664
• e!Ensembl: ENSG00000081181

Protein

• UniProt ID: P78540
• Protein name: Arginase-2, mitochondrial (EC 3.5.3.1) (Arginase II) (Kidney-type arginase) (Non-hepatic arginase) (Type II arginase)
• Protein function: May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS). Arginine metab
• PDB: 1PQ3, 4HZE, 4I06, 4IE2, 4IE3, 4IXU, 4IXV, 6Q37, 6Q39, 6SS2, 6SS4, 6SS6, 8RFA, 8RG6, 8RGF, 8RGU, 8RIM, 9FRV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00491	Arginase	24 → 324	Arginase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas. Expressed in acti
• Sequence:

  MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
  LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
  SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
  FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
  KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
  LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI

• Sequence length: 354

Pathways

KEGG:

Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Efferocytosis
Amoebiasis

Reactome:

Urea cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, PANCREATIC DUCTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	20693631	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12415579		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34257378	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12813015, 12813022, 16387594, 19281908, 20124949, 21512169, 22092728, 22712848, 28797075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16387594, 19281908, 21512169, 22092728, 28424066	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	19281908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	28969007		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36423363	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20542107, 27363017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lewis Lung	Lewis lung carcinoma	Pubtator	32923127	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23424623		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31821170, 32824856	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	23424623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	CTD_human_DG	23424623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24442486		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	16387594, 19281908, 20124949		★☆☆☆☆ Found in Text Mining only
Chloasma	Melasma	BEFREE	28627081		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	26487482, 31683763		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27104830	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29754953		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30338823		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31683763		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32121248	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30610061		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29185012	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28183205		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38287255	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28446459		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	11350073, 12859189, 26537638, 29956132		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18619832		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27363017, 28718378		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27363017, 28718378	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27363017, 28718378		★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	11081178		★☆☆☆☆ Found in Text Mining only
Gyrate Atrophy	Gyrate Atrophy	BEFREE	20811048		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	21130456		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15364894		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29896110		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30307989	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28446459		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28515179		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18528866		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23424623	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23424623, 30808864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18619832, 20711410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	23424623		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20542107		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30759381		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36604146	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30128151, 31280447		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30307989		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30338823		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26487482, 31683763		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23424623	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	20542107, 26514486, 31751318		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26054597, 30545920		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30962478		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25034973, 28808255, 30909461, 30962478		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27475813		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38494731	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	23424623		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28808255		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30523711		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28922848		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	23597578		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18619832, 20711410		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18202758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18619832, 20711410, 23424623, 32923127, 38581330	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	23424623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	29754953		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29754953		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30618589, 31280447		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12415579		★☆☆☆☆ Found in Text Mining only
Sexual Arousal Disorder	Sexual Arousal Disorder	BEFREE	12859189		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30808864		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26514486		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	23597578		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20542107		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20542107		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20542107	Associate	★☆☆☆☆ Found in Text Mining only