Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3833
Gene name	Kinesin family member C1
Gene symbol	KIFC1
Synonyms (NCBI Gene)	HSETKNSL2
Chromosome	6
Chromosome location	6p21.32

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024729	hsa-miR-215-5p	Microarray	19074876
MIRT051933	hsa-let-7b-5p	CLASH	23622248
MIRT049181	hsa-miR-92a-3p	CLASH	23622248
MIRT037124	hsa-miR-877-3p	CLASH	23622248
MIRT607373	hsa-miR-8485	HITS-CLIP	23313552
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23313552
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23313552
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	24906430
MIRT607373	hsa-miR-8485	HITS-CLIP	24906430
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	24906430
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	24906430
MIRT526861	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT526860	hsa-miR-4422	PAR-CLIP	22012620
MIRT526859	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT526858	hsa-miR-6865-3p	PAR-CLIP	22012620
MIRT526857	hsa-miR-4530	PAR-CLIP	22012620
MIRT526856	hsa-miR-338-3p	PAR-CLIP	22012620
MIRT526855	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT526854	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT526853	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT526852	hsa-miR-766-3p	PAR-CLIP	22012620
MIRT526851	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT526850	hsa-miR-1260a	PAR-CLIP	22012620
MIRT526849	hsa-miR-1260b	PAR-CLIP	22012620
MIRT607371	hsa-miR-135a-3p	Luciferase reporter assayqRT-PCRWestern blot	27366092
MIRT607371	hsa-miR-135a-3p	Luciferase reporter assayqRT-PCRWestern blot	27366092
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	27418678
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	27418678
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	27418678
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	27418678
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	27418678
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	27418678
MIRT607373	hsa-miR-8485	HITS-CLIP	23313552
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23313552
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23313552
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607372	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT607371	hsa-miR-135a-3p	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT607373	hsa-miR-8485	HITS-CLIP	23824327
MIRT526861	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT526860	hsa-miR-4422	PAR-CLIP	22012620
MIRT526859	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT526858	hsa-miR-6865-3p	PAR-CLIP	22012620
MIRT526857	hsa-miR-4530	PAR-CLIP	22012620
MIRT526856	hsa-miR-338-3p	PAR-CLIP	22012620
MIRT526855	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT526854	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT526853	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT526852	hsa-miR-766-3p	PAR-CLIP	22012620
MIRT526851	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT526850	hsa-miR-1260a	PAR-CLIP	22012620
MIRT526849	hsa-miR-1260b	PAR-CLIP	22012620
MIRT1095148	hsa-miR-376c	CLIP-seq
MIRT1095149	hsa-miR-4782-5p	CLIP-seq
MIRT2025506	hsa-miR-1260	CLIP-seq
MIRT2025507	hsa-miR-1280	CLIP-seq
MIRT1095149	hsa-miR-4782-5p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	NAS	8276466
GO:0000166	Function	Nucleotide binding	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0003777	Function	Microtubule motor activity	NAS	8276466
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	8276466
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	15843429
GO:0007283	Process	Spermatogenesis	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IBA
GO:0090307	Process	Mitotic spindle assembly	IBA
GO:0090307	Process	Mitotic spindle assembly	IMP	15843429

MIM	HGNC	e!Ensembl
603763	6389	ENSG00000237649

Q9BW19

Protein name

Kinesin-like protein KIFC1 (Kinesin-like protein 2) (Kinesin-related protein HSET)

Protein function

Minus end-directed microtubule-dependent motor required for bipolar spindle formation (PubMed:15843429). May contribute to movement of early endocytic vesicles (By similarity). Regulates cilium formation and structure (By similarity). {ECO:00002

PDB

5WDH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	349 → 663	Kinesin motor domain	Domain

Sequence

MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATT
KITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTS
GVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKA
LGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEE
RRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL
HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSLSRSDERRGTL
SGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKG
QGGECEIRRAGPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHS
VFQLQISGEHSSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG
LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKV
NQCVIGTAQANRK

Sequence length

673

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26992853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	20599806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31278883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25788277, 26177331, 26527623, 29848688, 31577729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25788277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26177331, 28218233, 38003261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38112634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28901309, 29620256, 34737790, 39596041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31278883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26992853	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36565617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37789080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26992853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27489338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	BEFREE	10369922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29562961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29888640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26992853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37955677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33588605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29620256, 30115976, 31340839, 31577729, 31666105, 31788047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25788277, 26177331, 26527623, 29848688, 31577729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30431618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25028599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27665358, 30744126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27176706, 28964573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	28977870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31278883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26987684, 29888640, 31577729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28789376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30991738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25028599, 26992853, 29535384, 29562961, 29620256, 30115976, 31278883, 31577729, 31788047		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30804089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30115976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35479190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	26992853		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25028599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25028599, 26992853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33361741	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38112634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	10369922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27665358, 30744126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33760984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29562961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	28977870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28964573, 31577729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36990154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27176706, 28964573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28218233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28218233, 29535384	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

KIFC1 (kinesin family member C1)