Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3831
Gene name	Kinesin light chain 1
Gene symbol	KLC1
Synonyms (NCBI Gene)	KLCKNS2KNS2A
Chromosome	14
Chromosome location	14q32.33
Summary	Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various c

228

Show/Hide all (228)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004189	hsa-miR-197-3p	Microarray	16822819
MIRT025439	hsa-miR-34a-5p	Proteomics	21566225
MIRT1095542	hsa-miR-105	CLIP-seq
MIRT1095543	hsa-miR-1289	CLIP-seq
MIRT1095544	hsa-miR-1321	CLIP-seq
MIRT1095545	hsa-miR-147	CLIP-seq
MIRT1095546	hsa-miR-15a	CLIP-seq
MIRT1095547	hsa-miR-15b	CLIP-seq
MIRT1095548	hsa-miR-16	CLIP-seq
MIRT1095549	hsa-miR-1915	CLIP-seq
MIRT1095550	hsa-miR-195	CLIP-seq
MIRT1095551	hsa-miR-221	CLIP-seq
MIRT1095552	hsa-miR-222	CLIP-seq
MIRT1095553	hsa-miR-296-5p	CLIP-seq
MIRT1095554	hsa-miR-3065-3p	CLIP-seq
MIRT1095555	hsa-miR-3120-3p	CLIP-seq
MIRT1095556	hsa-miR-3123	CLIP-seq
MIRT1095557	hsa-miR-3126-3p	CLIP-seq
MIRT1095558	hsa-miR-3128	CLIP-seq
MIRT1095559	hsa-miR-3162-5p	CLIP-seq
MIRT1095560	hsa-miR-34b	CLIP-seq
MIRT1095561	hsa-miR-361-3p	CLIP-seq
MIRT1095562	hsa-miR-365	CLIP-seq
MIRT1095563	hsa-miR-3663-3p	CLIP-seq
MIRT1095564	hsa-miR-374c	CLIP-seq
MIRT1095565	hsa-miR-377	CLIP-seq
MIRT1095566	hsa-miR-3914	CLIP-seq
MIRT1095567	hsa-miR-3925-5p	CLIP-seq
MIRT1095568	hsa-miR-3945	CLIP-seq
MIRT1095569	hsa-miR-411	CLIP-seq
MIRT1095570	hsa-miR-421	CLIP-seq
MIRT1095571	hsa-miR-424	CLIP-seq
MIRT1095572	hsa-miR-4420	CLIP-seq
MIRT1095573	hsa-miR-4470	CLIP-seq
MIRT1095574	hsa-miR-4666-5p	CLIP-seq
MIRT1095575	hsa-miR-4670-3p	CLIP-seq
MIRT1095576	hsa-miR-4672	CLIP-seq
MIRT1095577	hsa-miR-4685-5p	CLIP-seq
MIRT1095578	hsa-miR-4709-5p	CLIP-seq
MIRT1095579	hsa-miR-4718	CLIP-seq
MIRT1095580	hsa-miR-4719	CLIP-seq
MIRT1095581	hsa-miR-4720-5p	CLIP-seq
MIRT1095582	hsa-miR-4731-3p	CLIP-seq
MIRT1095583	hsa-miR-4739	CLIP-seq
MIRT1095584	hsa-miR-4756-5p	CLIP-seq
MIRT1095585	hsa-miR-4781-5p	CLIP-seq
MIRT1095586	hsa-miR-4799-3p	CLIP-seq
MIRT1095587	hsa-miR-4801	CLIP-seq
MIRT1095588	hsa-miR-486-3p	CLIP-seq
MIRT1095589	hsa-miR-497	CLIP-seq
MIRT1095590	hsa-miR-505	CLIP-seq
MIRT1095591	hsa-miR-513a-3p	CLIP-seq
MIRT1095592	hsa-miR-545	CLIP-seq
MIRT1095593	hsa-miR-581	CLIP-seq
MIRT1095594	hsa-miR-582-5p	CLIP-seq
MIRT1095595	hsa-miR-598	CLIP-seq
MIRT1095596	hsa-miR-615-3p	CLIP-seq
MIRT1095597	hsa-miR-655	CLIP-seq
MIRT1095598	hsa-miR-656	CLIP-seq
MIRT1095599	hsa-miR-744	CLIP-seq
MIRT1095600	hsa-miR-873	CLIP-seq
MIRT1095542	hsa-miR-105	CLIP-seq
MIRT2025678	hsa-miR-1246	CLIP-seq
MIRT2025679	hsa-miR-1290	CLIP-seq
MIRT1095545	hsa-miR-147	CLIP-seq
MIRT1095546	hsa-miR-15a	CLIP-seq
MIRT1095547	hsa-miR-15b	CLIP-seq
MIRT1095548	hsa-miR-16	CLIP-seq
MIRT1095550	hsa-miR-195	CLIP-seq
MIRT1095551	hsa-miR-221	CLIP-seq
MIRT1095552	hsa-miR-222	CLIP-seq
MIRT1095554	hsa-miR-3065-3p	CLIP-seq
MIRT2025680	hsa-miR-3117-5p	CLIP-seq
MIRT1095555	hsa-miR-3120-3p	CLIP-seq
MIRT1095557	hsa-miR-3126-3p	CLIP-seq
MIRT2025681	hsa-miR-3167	CLIP-seq
MIRT2025682	hsa-miR-3174	CLIP-seq
MIRT1095560	hsa-miR-34b	CLIP-seq
MIRT1095562	hsa-miR-365	CLIP-seq
MIRT1095563	hsa-miR-3663-3p	CLIP-seq
MIRT1095564	hsa-miR-374c	CLIP-seq
MIRT1095565	hsa-miR-377	CLIP-seq
MIRT1095566	hsa-miR-3914	CLIP-seq
MIRT1095568	hsa-miR-3945	CLIP-seq
MIRT1095569	hsa-miR-411	CLIP-seq
MIRT1095570	hsa-miR-421	CLIP-seq
MIRT1095571	hsa-miR-424	CLIP-seq
MIRT1095572	hsa-miR-4420	CLIP-seq
MIRT2025683	hsa-miR-4477a	CLIP-seq
MIRT2025684	hsa-miR-4504	CLIP-seq
MIRT2025685	hsa-miR-4636	CLIP-seq
MIRT1095574	hsa-miR-4666-5p	CLIP-seq
MIRT1095576	hsa-miR-4672	CLIP-seq
MIRT2025686	hsa-miR-4694-3p	CLIP-seq
MIRT1095578	hsa-miR-4709-5p	CLIP-seq
MIRT1095580	hsa-miR-4719	CLIP-seq
MIRT1095582	hsa-miR-4731-3p	CLIP-seq
MIRT2025687	hsa-miR-4775	CLIP-seq
MIRT1095587	hsa-miR-4801	CLIP-seq
MIRT1095588	hsa-miR-486-3p	CLIP-seq
MIRT1095589	hsa-miR-497	CLIP-seq
MIRT1095590	hsa-miR-505	CLIP-seq
MIRT1095591	hsa-miR-513a-3p	CLIP-seq
MIRT2025688	hsa-miR-522	CLIP-seq
MIRT2025689	hsa-miR-542-3p	CLIP-seq
MIRT1095592	hsa-miR-545	CLIP-seq
MIRT1095593	hsa-miR-581	CLIP-seq
MIRT1095594	hsa-miR-582-5p	CLIP-seq
MIRT2025690	hsa-miR-590-3p	CLIP-seq
MIRT1095595	hsa-miR-598	CLIP-seq
MIRT1095597	hsa-miR-655	CLIP-seq
MIRT1095600	hsa-miR-873	CLIP-seq
MIRT2025691	hsa-miR-876-5p	CLIP-seq
MIRT1095542	hsa-miR-105	CLIP-seq
MIRT2256866	hsa-miR-1286	CLIP-seq
MIRT1095545	hsa-miR-147	CLIP-seq
MIRT1095546	hsa-miR-15a	CLIP-seq
MIRT1095547	hsa-miR-15b	CLIP-seq
MIRT1095548	hsa-miR-16	CLIP-seq
MIRT2256867	hsa-miR-185	CLIP-seq
MIRT1095550	hsa-miR-195	CLIP-seq
MIRT1095551	hsa-miR-221	CLIP-seq
MIRT1095552	hsa-miR-222	CLIP-seq
MIRT1095554	hsa-miR-3065-3p	CLIP-seq
MIRT2025680	hsa-miR-3117-5p	CLIP-seq
MIRT1095555	hsa-miR-3120-3p	CLIP-seq
MIRT1095557	hsa-miR-3126-3p	CLIP-seq
MIRT1095558	hsa-miR-3128	CLIP-seq
MIRT2256868	hsa-miR-3154	CLIP-seq
MIRT2256869	hsa-miR-3197	CLIP-seq
MIRT1095560	hsa-miR-34b	CLIP-seq
MIRT2256870	hsa-miR-3609	CLIP-seq
MIRT1095562	hsa-miR-365	CLIP-seq
MIRT1095563	hsa-miR-3663-3p	CLIP-seq
MIRT1095565	hsa-miR-377	CLIP-seq
MIRT1095566	hsa-miR-3914	CLIP-seq
MIRT1095568	hsa-miR-3945	CLIP-seq
MIRT1095569	hsa-miR-411	CLIP-seq
MIRT1095570	hsa-miR-421	CLIP-seq
MIRT1095571	hsa-miR-424	CLIP-seq
MIRT2256871	hsa-miR-4302	CLIP-seq
MIRT2256872	hsa-miR-4305	CLIP-seq
MIRT2256873	hsa-miR-4306	CLIP-seq
MIRT2256874	hsa-miR-4312	CLIP-seq
MIRT1095572	hsa-miR-4420	CLIP-seq
MIRT2256875	hsa-miR-4435	CLIP-seq
MIRT1095573	hsa-miR-4470	CLIP-seq
MIRT2025684	hsa-miR-4504	CLIP-seq
MIRT2256876	hsa-miR-4644	CLIP-seq
MIRT1095574	hsa-miR-4666-5p	CLIP-seq
MIRT1095576	hsa-miR-4672	CLIP-seq
MIRT1095578	hsa-miR-4709-5p	CLIP-seq
MIRT1095579	hsa-miR-4718	CLIP-seq
MIRT1095580	hsa-miR-4719	CLIP-seq
MIRT1095581	hsa-miR-4720-5p	CLIP-seq
MIRT2256877	hsa-miR-4722-5p	CLIP-seq
MIRT2256878	hsa-miR-4734	CLIP-seq
MIRT2256879	hsa-miR-4768-3p	CLIP-seq
MIRT1095586	hsa-miR-4799-3p	CLIP-seq
MIRT2256880	hsa-miR-485-5p	CLIP-seq
MIRT1095588	hsa-miR-486-3p	CLIP-seq
MIRT1095589	hsa-miR-497	CLIP-seq
MIRT1095590	hsa-miR-505	CLIP-seq
MIRT1095591	hsa-miR-513a-3p	CLIP-seq
MIRT2256881	hsa-miR-520g	CLIP-seq
MIRT2256882	hsa-miR-520h	CLIP-seq
MIRT2256883	hsa-miR-532-5p	CLIP-seq
MIRT2025689	hsa-miR-542-3p	CLIP-seq
MIRT1095592	hsa-miR-545	CLIP-seq
MIRT2256884	hsa-miR-548ah	CLIP-seq
MIRT1095593	hsa-miR-581	CLIP-seq
MIRT1095595	hsa-miR-598	CLIP-seq
MIRT2256885	hsa-miR-606	CLIP-seq
MIRT1095600	hsa-miR-873	CLIP-seq
MIRT2025678	hsa-miR-1246	CLIP-seq
MIRT2025679	hsa-miR-1290	CLIP-seq
MIRT1095551	hsa-miR-221	CLIP-seq
MIRT1095552	hsa-miR-222	CLIP-seq
MIRT2025680	hsa-miR-3117-5p	CLIP-seq
MIRT1095557	hsa-miR-3126-3p	CLIP-seq
MIRT1095558	hsa-miR-3128	CLIP-seq
MIRT2025681	hsa-miR-3167	CLIP-seq
MIRT2256870	hsa-miR-3609	CLIP-seq
MIRT1095564	hsa-miR-374c	CLIP-seq
MIRT2558292	hsa-miR-3941	CLIP-seq
MIRT1095573	hsa-miR-4470	CLIP-seq
MIRT2025683	hsa-miR-4477a	CLIP-seq
MIRT2025685	hsa-miR-4636	CLIP-seq
MIRT2558293	hsa-miR-466	CLIP-seq
MIRT1095574	hsa-miR-4666-5p	CLIP-seq
MIRT1095576	hsa-miR-4672	CLIP-seq
MIRT2025686	hsa-miR-4694-3p	CLIP-seq
MIRT1095581	hsa-miR-4720-5p	CLIP-seq
MIRT2025687	hsa-miR-4775	CLIP-seq
MIRT1095586	hsa-miR-4799-3p	CLIP-seq
MIRT2256881	hsa-miR-520g	CLIP-seq
MIRT2256882	hsa-miR-520h	CLIP-seq
MIRT2025688	hsa-miR-522	CLIP-seq
MIRT2256884	hsa-miR-548ah	CLIP-seq
MIRT1095594	hsa-miR-582-5p	CLIP-seq
MIRT2025690	hsa-miR-590-3p	CLIP-seq
MIRT2256885	hsa-miR-606	CLIP-seq
MIRT1095597	hsa-miR-655	CLIP-seq
MIRT1095598	hsa-miR-656	CLIP-seq
MIRT2025691	hsa-miR-876-5p	CLIP-seq
MIRT2025678	hsa-miR-1246	CLIP-seq
MIRT2025679	hsa-miR-1290	CLIP-seq
MIRT2025680	hsa-miR-3117-5p	CLIP-seq
MIRT2025681	hsa-miR-3167	CLIP-seq
MIRT2256870	hsa-miR-3609	CLIP-seq
MIRT1095564	hsa-miR-374c	CLIP-seq
MIRT2558292	hsa-miR-3941	CLIP-seq
MIRT2025683	hsa-miR-4477a	CLIP-seq
MIRT2025685	hsa-miR-4636	CLIP-seq
MIRT2558293	hsa-miR-466	CLIP-seq
MIRT1095576	hsa-miR-4672	CLIP-seq
MIRT2025686	hsa-miR-4694-3p	CLIP-seq
MIRT2025687	hsa-miR-4775	CLIP-seq
MIRT2256881	hsa-miR-520g	CLIP-seq
MIRT2256882	hsa-miR-520h	CLIP-seq
MIRT2025688	hsa-miR-522	CLIP-seq
MIRT2256884	hsa-miR-548ah	CLIP-seq
MIRT1095594	hsa-miR-582-5p	CLIP-seq
MIRT2025690	hsa-miR-590-3p	CLIP-seq
MIRT2256885	hsa-miR-606	CLIP-seq
MIRT1095597	hsa-miR-655	CLIP-seq
MIRT1095598	hsa-miR-656	CLIP-seq
MIRT2025691	hsa-miR-876-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003774	Function	Cytoskeletal motor activity	TAS	8786116
GO:0005515	Function	Protein binding	IPI	14970196, 16938850, 17332754, 19861499, 25416956, 25898167, 32296183, 32814053, 36217029
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IEA
GO:0005871	Component	Kinesin complex	ISS
GO:0005871	Component	Kinesin complex	TAS
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019894	Function	Kinesin binding	IBA
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035617	Process	Stress granule disassembly	ISS
GO:0042995	Component	Cell projection	IEA

MIM	HGNC	e!Ensembl
600025	6387	ENSG00000126214

Q07866

Protein name

Kinesin light chain 1 (KLC 1)

Protein function

Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport (PubMed:21385839). The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (By simil

PDB

3NF1 , 5OJ8 , 7AI4 , 7AIE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13424	TPR_12	211 → 287		Repeat
PF00515	TPR_1	297 → 329	Tetratricopeptide repeat	Repeat
PF13374	TPR_10	463 → 502		Repeat

Tissue specificity

TISSUE SPECIFICITY: Found in a variety of tissues. Mostly abundant in brain and spine. {ECO:0000269|PubMed:14970196}.

Sequence

MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR

Sequence length

573

Interactions

View interactions

	KEGG		Reactome
	Motor proteins Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Salmonella infection		MHC class II antigen presentation RHO GTPases activate KTN1 COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS, RELAPSING-REMITTING	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	30154667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17653041, 22272245	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	24497505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31204277		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	Pubtator	17653041, 25883527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19911314, 25883527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract posterior polar 1	Congenital cataract	Pubtator	25883527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	40026415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Motor Neuron Disease	Motor Neuron Disease	BEFREE	10505649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30350109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31753813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29662059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	31204277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	17611642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10505649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17999208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17999208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24497505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22272245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30165355	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	19911314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 28540026, 30285260, 31268507, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	30820025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30820025	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26590607, 40228435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30165355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KLC1 (kinesin light chain 1)