Gene Gene information from NCBI Gene database.
Entrez ID 3822
Gene name Killer cell lectin like receptor C2
Gene symbol KLRC2
Synonyms (NCBI Gene)
CD159cNKG2-CNKG2C
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
27
miRTarBase ID miRNA Experiments Reference
MIRT017833 hsa-miR-335-5p Microarray 18185580
MIRT029433 hsa-miR-26b-5p Microarray 19088304
MIRT1099200 hsa-miR-125a-5p CLIP-seq
MIRT1099201 hsa-miR-125b CLIP-seq
MIRT1099202 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IDA 9655483
GO:0002228 Process Natural killer cell mediated immunity IDA 9655483
GO:0002228 Process Natural killer cell mediated immunity IDA 18448674
GO:0002250 Process Adaptive immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602891 6375 ENSG00000205809
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26717
Protein name NKG2-C type II integral membrane protein (CD159 antigen-like family member C) (NK cell receptor C) (NKG2-C-activating NK receptor) (CD antigen CD159c)
Protein function Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from n
PDB 2L35
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 134 229 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in NK cell subsets, in particular in adaptive CD57-positive NK cells (at protein level) (PubMed:20952657, PubMed:21825173). Expressed in terminally differentiated cytotoxic gamma-delta T cells (at protein level) (PubMed:20952
Sequence
MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSS
HHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKH
KL
Sequence length 231
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity
  DAP12 interactions
DAP12 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CREUTZFELDT-JAKOB DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CREUTZFELDT-JAKOB SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Arthritis BEFREE 17767552
★☆☆☆☆
Found in Text Mining only
ATRIAL SEPTAL DEFECT 1 Atrial Septal Defect BEFREE 31123562
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect BEFREE 31123562
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 31123562, 37352688 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 31123562
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome BEFREE 17767552
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet disease Pubtator 23336215 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 37081323 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 37501379 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 37919459 Associate
★☆☆☆☆
Found in Text Mining only