Gene Gene information from NCBI Gene database.
Entrez ID 3821
Gene name Killer cell lectin like receptor C1
Gene symbol KLRC1
Synonyms (NCBI Gene)
CD159ANKG2NKG2A
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t
miRNA miRNA information provided by mirtarbase database.
17
miRTarBase ID miRNA Experiments Reference
MIRT016715 hsa-miR-335-5p Microarray 18185580
MIRT019278 hsa-miR-148b-3p Microarray 17612493
MIRT021318 hsa-miR-9-5p Microarray 17612493
MIRT028761 hsa-miR-26b-5p Microarray 19088304
MIRT1099191 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IBA
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IDA 9485206
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0002250 Process Adaptive immune response IEA
GO:0002305 Process CD8-positive, gamma-delta intraepithelial T cell differentiation IDA 18064301
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
161555 6374 ENSG00000134545
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26715
Protein name NKG2-A/NKG2-B type II integral membrane protein (CD159 antigen-like family member A) (NK cell receptor A) (NKG2-A/B-activating NK receptor) (CD antigen CD159a)
Protein function Immune inhibitory receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides d
PDB 2RMX , 2YU7 , 3BDW , 3CDG , 3CII
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 136 231 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in NK cells (at protein level) (PubMed:20952657, PubMed:9430220, PubMed:9485206). Expressed in intraepithelial CD8-positive T cell subsets with higher frequency in gamma-delta T cells than alpha-beta T cells (at
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH
KL
Sequence length 233
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PSORIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 23454781
★☆☆☆☆
Found in Text Mining only
Angina Pectoris Angina pectoris Pubtator 26823790 Inhibit
★☆☆☆☆
Found in Text Mining only
Antiphospholipid Syndrome Antiphospholipid syndrome Pubtator 33103514 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 22102879, 24673109, 27783394 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 35606283 Associate
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 31676749
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Barrett esophagus BEFREE 31354725
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome BEFREE 17767552
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome LHGDN 17767552
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet disease Pubtator 30319620 Associate
★☆☆☆☆
Found in Text Mining only