Gene Gene information from NCBI Gene database.
Entrez ID 3802
Gene name Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
Gene symbol KIR2DL1
Synonyms (NCBI Gene)
CD158AKIR-K64KIR221KIR2DL3NKATNKAT-1NKAT1p58.1
Chromosome 19
Chromosome location 19q13.42
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT1095225 hsa-miR-1294 CLIP-seq
MIRT1095226 hsa-miR-3650 CLIP-seq
MIRT1095227 hsa-miR-3915 CLIP-seq
MIRT1095228 hsa-miR-3928 CLIP-seq
MIRT1095229 hsa-miR-4316 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0002769 Process Natural killer cell inhibitory signaling pathway IDA 18604210
GO:0005515 Function Protein binding IPI 8691146, 12853576, 18322206, 18604210, 18624290, 19858347, 28546555
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 18604210
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604936 6329 ENSG00000125498
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43626
Protein name Killer cell immunoglobulin-like receptor 2DL1 (CD158 antigen-like family member A) (Natural killer-associated transcript 1) (NKAT-1) (p58 natural killer cell receptor clones CL-42/47.11) (p58 NK receptor CL-42/47.11) (p58.1 MHC class-I-specific NK recepto
Protein function Receptor on natural killer (NK) cells for some HLA-C alleles such as w4 and w6. Inhibits the activity of NK cells thus preventing cell lysis.
PDB 1IM9 , 1NKR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 115 Immunoglobulin domain Domain
PF00047 ig 132 213 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by NK cells. {ECO:0000269|PubMed:9430221}.
Sequence
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPS
DPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSS
DPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Sequence length 348
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Keratoconus Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
KIR2DL1-related disorder Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations