Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3787
Gene name	Potassium voltage-gated channel modifier subfamily S member 1
Gene symbol	KCNS1
Synonyms (NCBI Gene)	Kv9.1hKv9.1
Chromosome	20
Chromosome location	20q13.12
Summary	Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the contro

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments
MIRT1082390	hsa-miR-1193	CLIP-seq
MIRT1082391	hsa-miR-1225-5p	CLIP-seq
MIRT1082392	hsa-miR-1254	CLIP-seq
MIRT1082393	hsa-miR-1293	CLIP-seq
MIRT1082394	hsa-miR-1324	CLIP-seq
MIRT1082395	hsa-miR-2861	CLIP-seq
MIRT1082396	hsa-miR-3116	CLIP-seq
MIRT1082397	hsa-miR-3174	CLIP-seq
MIRT1082398	hsa-miR-3175	CLIP-seq
MIRT1082399	hsa-miR-3185	CLIP-seq
MIRT1082400	hsa-miR-377	CLIP-seq
MIRT1082401	hsa-miR-3908	CLIP-seq
MIRT1082402	hsa-miR-3942-5p	CLIP-seq
MIRT1082403	hsa-miR-4265	CLIP-seq
MIRT1082404	hsa-miR-4296	CLIP-seq
MIRT1082405	hsa-miR-4322	CLIP-seq
MIRT1082406	hsa-miR-4483	CLIP-seq
MIRT1082407	hsa-miR-4643	CLIP-seq
MIRT1082408	hsa-miR-4658	CLIP-seq
MIRT1082409	hsa-miR-4703-5p	CLIP-seq
MIRT1082410	hsa-miR-4717-3p	CLIP-seq
MIRT1082411	hsa-miR-4720-3p	CLIP-seq
MIRT1082412	hsa-miR-4723-5p	CLIP-seq
MIRT1082413	hsa-miR-4756-3p	CLIP-seq
MIRT1082414	hsa-miR-4758-5p	CLIP-seq
MIRT1082415	hsa-miR-4765	CLIP-seq
MIRT1082416	hsa-miR-4766-3p	CLIP-seq
MIRT1082417	hsa-miR-4781-5p	CLIP-seq
MIRT1082418	hsa-miR-4804-3p	CLIP-seq
MIRT1082419	hsa-miR-548b-3p	CLIP-seq
MIRT1082420	hsa-miR-579	CLIP-seq
MIRT1082421	hsa-miR-653	CLIP-seq
MIRT1082422	hsa-miR-885-3p	CLIP-seq
MIRT2020506	hsa-miR-1178	CLIP-seq
MIRT2020507	hsa-miR-1266	CLIP-seq
MIRT1082393	hsa-miR-1293	CLIP-seq
MIRT2020508	hsa-miR-1304	CLIP-seq
MIRT2020509	hsa-miR-216a	CLIP-seq
MIRT1082398	hsa-miR-3175	CLIP-seq
MIRT2020510	hsa-miR-3614-3p	CLIP-seq
MIRT2020511	hsa-miR-3614-5p	CLIP-seq
MIRT2020512	hsa-miR-3616-3p	CLIP-seq
MIRT2020513	hsa-miR-3664-3p	CLIP-seq
MIRT2020514	hsa-miR-4436a	CLIP-seq
MIRT1082406	hsa-miR-4483	CLIP-seq
MIRT2020515	hsa-miR-4518	CLIP-seq
MIRT2020516	hsa-miR-4640-5p	CLIP-seq
MIRT2020517	hsa-miR-4721	CLIP-seq
MIRT1082412	hsa-miR-4723-5p	CLIP-seq
MIRT2020518	hsa-miR-4726-5p	CLIP-seq
MIRT1082417	hsa-miR-4781-5p	CLIP-seq
MIRT2020519	hsa-miR-668	CLIP-seq
MIRT2020520	hsa-miR-873	CLIP-seq
MIRT1082422	hsa-miR-885-3p	CLIP-seq
MIRT2020507	hsa-miR-1266	CLIP-seq
MIRT2252246	hsa-miR-1972	CLIP-seq
MIRT2020509	hsa-miR-216a	CLIP-seq
MIRT2020513	hsa-miR-3664-3p	CLIP-seq
MIRT2020514	hsa-miR-4436a	CLIP-seq
MIRT2252247	hsa-miR-4492	CLIP-seq
MIRT2252248	hsa-miR-4498	CLIP-seq
MIRT2020515	hsa-miR-4518	CLIP-seq
MIRT2252249	hsa-miR-4650-5p	CLIP-seq
MIRT2252250	hsa-miR-762	CLIP-seq
MIRT2389692	hsa-miR-1302	CLIP-seq
MIRT2389693	hsa-miR-4298	CLIP-seq
MIRT1082413	hsa-miR-4756-3p	CLIP-seq
MIRT2555563	hsa-miR-1253	CLIP-seq
MIRT2555564	hsa-miR-149	CLIP-seq
MIRT2555565	hsa-miR-214	CLIP-seq
MIRT2555566	hsa-miR-3167	CLIP-seq
MIRT2555567	hsa-miR-3619-5p	CLIP-seq
MIRT2555568	hsa-miR-3665	CLIP-seq
MIRT2555569	hsa-miR-4291	CLIP-seq
MIRT2555570	hsa-miR-4292	CLIP-seq
MIRT2555571	hsa-miR-4308	CLIP-seq
MIRT2555572	hsa-miR-4699-5p	CLIP-seq
MIRT2555573	hsa-miR-4709-3p	CLIP-seq
MIRT2555574	hsa-miR-4766-5p	CLIP-seq
MIRT2555575	hsa-miR-488	CLIP-seq
MIRT2555576	hsa-miR-670	CLIP-seq
MIRT2555577	hsa-miR-760	CLIP-seq
MIRT2555578	hsa-miR-761	CLIP-seq
MIRT2555579	hsa-miR-876-5p	CLIP-seq
MIRT2555580	hsa-miR-922	CLIP-seq
MIRT2555564	hsa-miR-149	CLIP-seq
MIRT2683246	hsa-miR-24	CLIP-seq
MIRT2683247	hsa-miR-3064-5p	CLIP-seq
MIRT2555566	hsa-miR-3167	CLIP-seq
MIRT2683248	hsa-miR-3977	CLIP-seq
MIRT2683249	hsa-miR-4284	CLIP-seq
MIRT2555570	hsa-miR-4292	CLIP-seq
MIRT2555571	hsa-miR-4308	CLIP-seq
MIRT2683250	hsa-miR-4469	CLIP-seq
MIRT2683251	hsa-miR-4763-5p	CLIP-seq
MIRT2555574	hsa-miR-4766-5p	CLIP-seq
MIRT2683252	hsa-miR-4794	CLIP-seq
MIRT2555575	hsa-miR-488	CLIP-seq
MIRT2683253	hsa-miR-642a	CLIP-seq
MIRT2555576	hsa-miR-670	CLIP-seq
MIRT2555577	hsa-miR-760	CLIP-seq
MIRT2555579	hsa-miR-876-5p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	10484328
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	10484328
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	9305895, 10484328
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	10484328
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	10484328
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0015459	Function	Potassium channel regulator activity	TAS	9305895
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	10484328
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS

MIM	HGNC	e!Ensembl
602905	6300	ENSG00000124134

Q96KK3

Protein name

Delayed-rectifier potassium channel regulatory subunit KCNS1 (Delayed-rectifier K(+) channel alpha subunit 1) (Delayed-rectifier potassium channel subunit Kv9.1) (hKv9.1) (Potassium voltage-gated channel modifier subfamily S member 1)

Protein function

Potassium channel regulatory subunit that modulate the delayed rectifier voltage-gated potassium channel activity of KCNB1 and KCNB2 by altering their kinetics, expression levels, and shifting the half-inactivation potential to more polarized va

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	52 → 151	BTB/POZ domain	Domain
PF00520	Ion_trans	219 → 468	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues tested with the exception of skeletal muscle (PubMed:10484328). Highly expressed in adult and fetal brain, fetal kidney and lung, and adult prostate and testis (PubMed:10484328). {ECO:0000269|PubMed:10484328}.

Sequence

MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR
RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST
GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ
EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY

Sequence length

526

Interactions

View interactions

	Reactome
			Voltage gated Potassium channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	24373571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24373571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	26945673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24373571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	27487831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29568943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	23314412		★★★★★ ★☆☆☆☆ Found in Text Mining only

KCNS1 (potassium voltage-gated channel modifier subfamily S member 1)