Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3765
Gene name	Potassium inwardly rectifying channel subfamily J member 9
Gene symbol	KCNJ9
Synonyms (NCBI Gene)	GIRK3KIR3.3
Chromosome	1
Chromosome location	1q23.2
Summary	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017196	hsa-miR-335-5p	Microarray	18185580
MIRT021726	hsa-miR-132-3p	Microarray	17612493
MIRT722470	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT722469	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT722468	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT722467	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT722466	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT722470	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT722469	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT722468	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT722467	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT722466	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT1081655	hsa-miR-1236	CLIP-seq
MIRT1081656	hsa-miR-3074-5p	CLIP-seq
MIRT1081657	hsa-miR-3183	CLIP-seq
MIRT1081658	hsa-miR-4722-3p	CLIP-seq
MIRT1081659	hsa-miR-4723-3p	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq
MIRT1920549	hsa-miR-103a	CLIP-seq
MIRT1920550	hsa-miR-107	CLIP-seq
MIRT1920551	hsa-miR-15a	CLIP-seq
MIRT1920552	hsa-miR-15b	CLIP-seq
MIRT1920553	hsa-miR-16	CLIP-seq
MIRT1920554	hsa-miR-195	CLIP-seq
MIRT1920555	hsa-miR-338-3p	CLIP-seq
MIRT1920556	hsa-miR-3661	CLIP-seq
MIRT1920557	hsa-miR-424	CLIP-seq
MIRT1920558	hsa-miR-4530	CLIP-seq
MIRT1920559	hsa-miR-455-3p	CLIP-seq
MIRT1920560	hsa-miR-497	CLIP-seq
MIRT1920561	hsa-miR-631	CLIP-seq
MIRT1920549	hsa-miR-103a	CLIP-seq
MIRT1920550	hsa-miR-107	CLIP-seq
MIRT1920551	hsa-miR-15a	CLIP-seq
MIRT1920552	hsa-miR-15b	CLIP-seq
MIRT1920553	hsa-miR-16	CLIP-seq
MIRT1920554	hsa-miR-195	CLIP-seq
MIRT1920555	hsa-miR-338-3p	CLIP-seq
MIRT1920556	hsa-miR-3661	CLIP-seq
MIRT1920557	hsa-miR-424	CLIP-seq
MIRT1920558	hsa-miR-4530	CLIP-seq
MIRT1920559	hsa-miR-455-3p	CLIP-seq
MIRT1920560	hsa-miR-497	CLIP-seq
MIRT1920561	hsa-miR-631	CLIP-seq
MIRT1081655	hsa-miR-1236	CLIP-seq
MIRT2020222	hsa-miR-223	CLIP-seq
MIRT2020223	hsa-miR-3152-5p	CLIP-seq
MIRT1081657	hsa-miR-3183	CLIP-seq
MIRT2020224	hsa-miR-323b-5p	CLIP-seq
MIRT2020225	hsa-miR-3667-3p	CLIP-seq
MIRT2020226	hsa-miR-4297	CLIP-seq
MIRT2020227	hsa-miR-4328	CLIP-seq
MIRT2020228	hsa-miR-4452	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq
MIRT2020229	hsa-miR-4697-3p	CLIP-seq
MIRT1081659	hsa-miR-4723-3p	CLIP-seq
MIRT2020230	hsa-miR-4774-3p	CLIP-seq
MIRT1920549	hsa-miR-103a	CLIP-seq
MIRT1920550	hsa-miR-107	CLIP-seq
MIRT2252046	hsa-miR-125a-3p	CLIP-seq
MIRT1920551	hsa-miR-15a	CLIP-seq
MIRT1920552	hsa-miR-15b	CLIP-seq
MIRT1920553	hsa-miR-16	CLIP-seq
MIRT2252047	hsa-miR-1910	CLIP-seq
MIRT1920554	hsa-miR-195	CLIP-seq
MIRT1920555	hsa-miR-338-3p	CLIP-seq
MIRT1920557	hsa-miR-424	CLIP-seq
MIRT2252048	hsa-miR-4264	CLIP-seq
MIRT2252049	hsa-miR-4290	CLIP-seq
MIRT1920558	hsa-miR-4530	CLIP-seq
MIRT1920559	hsa-miR-455-3p	CLIP-seq
MIRT2252050	hsa-miR-4687-5p	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq
MIRT2252051	hsa-miR-483-3p	CLIP-seq
MIRT1920560	hsa-miR-497	CLIP-seq
MIRT1081655	hsa-miR-1236	CLIP-seq
MIRT2020223	hsa-miR-3152-5p	CLIP-seq
MIRT1081657	hsa-miR-3183	CLIP-seq
MIRT2020225	hsa-miR-3667-3p	CLIP-seq
MIRT2020226	hsa-miR-4297	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq
MIRT1081659	hsa-miR-4723-3p	CLIP-seq
MIRT2389653	hsa-miR-4753-3p	CLIP-seq
MIRT2020230	hsa-miR-4774-3p	CLIP-seq
MIRT2389654	hsa-miR-942	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq
MIRT1550411	hsa-miR-4691-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IBA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	12297500, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0099094	Function	Ligand-gated monoatomic cation channel activity	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:1902937	Component	Inward rectifier potassium channel complex	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA

MIM	HGNC	e!Ensembl
600932	6270	ENSG00000162728

Q92806

Protein name

G protein-activated inward rectifier potassium channel 3 (GIRK-3) (Inward rectifier K(+) channel Kir3.3) (Potassium channel, inwardly rectifying subfamily J member 9)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass

PDB

6X23

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	25 → 164	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	171 → 343	Inward rectifier potassium channel C-terminal domain	Domain

Sequence

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV

Sequence length

393

Interactions

View interactions

	KEGG		Reactome
	Circadian entrainment Retrograde endocannabinoid signaling Serotonergic synapse Dopaminergic synapse Estrogen signaling pathway Oxytocin signaling pathway GnRH secretion Morphine addiction		Activation of G protein gated Potassium channels Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Diabetes	Diabetes	BEFREE	11350189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11350189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10913335, 11350189, 12401729	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	19864112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	23872692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16109170	★★★★★ ★☆☆☆☆ Found in Text Mining only

KCNJ9 (potassium inwardly rectifying channel subfamily J member 9)