Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3764
Gene name	Potassium inwardly rectifying channel subfamily J member 8
Gene symbol	KCNJ8
Synonyms (NCBI Gene)	KIR6.1uKATP-1
Chromosome	12
Chromosome location	12p12.1
Summary	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

277

Show/Hide all (277)

miRTarBase ID	miRNA	Experiments	Reference
MIRT536557	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536556	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536555	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536554	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536553	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536552	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536551	hsa-miR-302e	PAR-CLIP	22012620
MIRT536550	hsa-miR-520b	PAR-CLIP	22012620
MIRT536549	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536548	hsa-miR-520e	PAR-CLIP	22012620
MIRT536547	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536546	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536545	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT536544	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT536543	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT536542	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT536541	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT536540	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT536539	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT536538	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT536537	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT536536	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT536535	hsa-miR-556-3p	PAR-CLIP	22012620
MIRT536557	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536556	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536555	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536554	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536553	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536552	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536551	hsa-miR-302e	PAR-CLIP	22012620
MIRT536550	hsa-miR-520b	PAR-CLIP	22012620
MIRT536549	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536548	hsa-miR-520e	PAR-CLIP	22012620
MIRT536547	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536546	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536545	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT536544	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT536543	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT536542	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT536541	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT536540	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT536539	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT536538	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT536537	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT536536	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT536535	hsa-miR-556-3p	PAR-CLIP	22012620
MIRT1081594	hsa-miR-106a	CLIP-seq
MIRT1081595	hsa-miR-106b	CLIP-seq
MIRT1081596	hsa-miR-1197	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081599	hsa-miR-1273e	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081601	hsa-miR-17	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT1081603	hsa-miR-20a	CLIP-seq
MIRT1081604	hsa-miR-20b	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT1081607	hsa-miR-302a	CLIP-seq
MIRT1081608	hsa-miR-302b	CLIP-seq
MIRT1081609	hsa-miR-302c	CLIP-seq
MIRT1081610	hsa-miR-302d	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081612	hsa-miR-3128	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081615	hsa-miR-3152-3p	CLIP-seq
MIRT1081616	hsa-miR-3154	CLIP-seq
MIRT1081617	hsa-miR-34a	CLIP-seq
MIRT1081618	hsa-miR-34c-5p	CLIP-seq
MIRT1081619	hsa-miR-3591-5p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT1081621	hsa-miR-3650	CLIP-seq
MIRT1081622	hsa-miR-3662	CLIP-seq
MIRT1081623	hsa-miR-3668	CLIP-seq
MIRT1081624	hsa-miR-371b-3p	CLIP-seq
MIRT1081625	hsa-miR-372	CLIP-seq
MIRT1081626	hsa-miR-373	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081630	hsa-miR-4280	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT1081638	hsa-miR-449a	CLIP-seq
MIRT1081639	hsa-miR-449b	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT1081641	hsa-miR-4517	CLIP-seq
MIRT1081642	hsa-miR-4720-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081644	hsa-miR-4729	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT1081646	hsa-miR-4799-3p	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081649	hsa-miR-519d	CLIP-seq
MIRT1081650	hsa-miR-622	CLIP-seq
MIRT1081651	hsa-miR-642b	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081653	hsa-miR-93	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1550410	hsa-miR-4728-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT2252042	hsa-miR-3074-3p	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2252043	hsa-miR-34c-3p	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT2252044	hsa-miR-4666-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1550410	hsa-miR-4728-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2252045	hsa-miR-494	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT1081598	hsa-miR-1252	CLIP-seq
MIRT1081600	hsa-miR-134	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT2252042	hsa-miR-3074-3p	CLIP-seq
MIRT1081611	hsa-miR-3118	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2252043	hsa-miR-34c-3p	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT2252044	hsa-miR-4666-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT1081654	hsa-miR-943	CLIP-seq
MIRT2555393	hsa-miR-105	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT2555394	hsa-miR-129-5p	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT2555395	hsa-miR-1913	CLIP-seq
MIRT2555396	hsa-miR-198	CLIP-seq
MIRT2555397	hsa-miR-205	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT2555398	hsa-miR-3124-3p	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2555399	hsa-miR-3152-5p	CLIP-seq
MIRT2555400	hsa-miR-3155	CLIP-seq
MIRT2555401	hsa-miR-3155b	CLIP-seq
MIRT2555402	hsa-miR-3194-3p	CLIP-seq
MIRT2555403	hsa-miR-324-3p	CLIP-seq
MIRT2555404	hsa-miR-3545-3p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT2555405	hsa-miR-3679-3p	CLIP-seq
MIRT2555406	hsa-miR-3685	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT2555407	hsa-miR-4328	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT2555408	hsa-miR-4436b-5p	CLIP-seq
MIRT2555409	hsa-miR-4446-5p	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT2555410	hsa-miR-4503	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT2555411	hsa-miR-4774-3p	CLIP-seq
MIRT2555412	hsa-miR-484	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2555413	hsa-miR-516a-3p	CLIP-seq
MIRT2555414	hsa-miR-520d-5p	CLIP-seq
MIRT2555415	hsa-miR-524-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq
MIRT2555393	hsa-miR-105	CLIP-seq
MIRT1081597	hsa-miR-1208	CLIP-seq
MIRT2683233	hsa-miR-1273f	CLIP-seq
MIRT2555394	hsa-miR-129-5p	CLIP-seq
MIRT2683234	hsa-miR-143	CLIP-seq
MIRT1081602	hsa-miR-1910	CLIP-seq
MIRT2555395	hsa-miR-1913	CLIP-seq
MIRT2555396	hsa-miR-198	CLIP-seq
MIRT2555397	hsa-miR-205	CLIP-seq
MIRT1081605	hsa-miR-2110	CLIP-seq
MIRT1081606	hsa-miR-2681	CLIP-seq
MIRT2555398	hsa-miR-3124-3p	CLIP-seq
MIRT1081613	hsa-miR-3130-5p	CLIP-seq
MIRT1081614	hsa-miR-3151	CLIP-seq
MIRT2555399	hsa-miR-3152-5p	CLIP-seq
MIRT2555400	hsa-miR-3155	CLIP-seq
MIRT2555401	hsa-miR-3155b	CLIP-seq
MIRT2683235	hsa-miR-3171	CLIP-seq
MIRT2555402	hsa-miR-3194-3p	CLIP-seq
MIRT2555403	hsa-miR-324-3p	CLIP-seq
MIRT2555404	hsa-miR-3545-3p	CLIP-seq
MIRT2683236	hsa-miR-3619-3p	CLIP-seq
MIRT1081620	hsa-miR-3646	CLIP-seq
MIRT2555406	hsa-miR-3685	CLIP-seq
MIRT1081627	hsa-miR-3929	CLIP-seq
MIRT1081628	hsa-miR-4267	CLIP-seq
MIRT1081629	hsa-miR-4271	CLIP-seq
MIRT1081631	hsa-miR-4318	CLIP-seq
MIRT2555407	hsa-miR-4328	CLIP-seq
MIRT1081632	hsa-miR-4419b	CLIP-seq
MIRT1081633	hsa-miR-4434	CLIP-seq
MIRT2555408	hsa-miR-4436b-5p	CLIP-seq
MIRT1081634	hsa-miR-4447	CLIP-seq
MIRT1081635	hsa-miR-4472	CLIP-seq
MIRT1081636	hsa-miR-4478	CLIP-seq
MIRT1081637	hsa-miR-4482	CLIP-seq
MIRT2555410	hsa-miR-4503	CLIP-seq
MIRT1081640	hsa-miR-4516	CLIP-seq
MIRT2683237	hsa-miR-4708-5p	CLIP-seq
MIRT1081643	hsa-miR-4725-3p	CLIP-seq
MIRT1081645	hsa-miR-4768-3p	CLIP-seq
MIRT2683238	hsa-miR-4770	CLIP-seq
MIRT2555411	hsa-miR-4774-3p	CLIP-seq
MIRT2683239	hsa-miR-4776-5p	CLIP-seq
MIRT2555412	hsa-miR-484	CLIP-seq
MIRT1081647	hsa-miR-490-5p	CLIP-seq
MIRT1081648	hsa-miR-491-5p	CLIP-seq
MIRT2555413	hsa-miR-516a-3p	CLIP-seq
MIRT2555414	hsa-miR-520d-5p	CLIP-seq
MIRT2555415	hsa-miR-524-5p	CLIP-seq
MIRT1081652	hsa-miR-668	CLIP-seq

Show/Hide all (95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001944	Process	Vasculature development	IEA
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003229	Process	Ventricular cardiac muscle tissue development	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	TAS	7890693
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	7890693
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007507	Process	Heart development	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	7890693
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008282	Component	Inward rectifying potassium channel	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009306	Process	Protein secretion	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IBA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IDA	20558321
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IEA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IMP	21836131, 24700710
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	NAS	28842488
GO:0015908	Process	Fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017098	Function	Sulfonylurea receptor binding	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	ISS
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030016	Component	Myofibril	IEA
GO:0031004	Component	Potassium ion-transporting ATPase complex	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0050877	Process	Nervous system process	IEA
GO:0050905	Process	Neuromuscular process	IEA
GO:0051124	Process	Synaptic assembly at neuromuscular junction	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0060920	Process	Cardiac pacemaker cell differentiation	IEA
GO:0060922	Process	Atrioventricular node cell differentiation	IEA
GO:0060976	Process	Coronary vasculature development	IEA
GO:0061535	Process	Glutamate secretion, neurotransmission	IEA
GO:0061762	Process	CAMKK-AMPK signaling cascade	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	NAS	28842488
GO:0072359	Process	Circulatory system development	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098915	Process	Membrane repolarization during ventricular cardiac muscle cell action potential	IMP	20558321
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IDA	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IMP	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	NAS	18945825
GO:0150103	Process	Reactive gliosis	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902282	Function	Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IMP	20558321
GO:1904638	Process	Response to resveratrol	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	20558321
GO:1990573	Process	Potassium ion import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
600935	6269	ENSG00000121361

Q15842

Protein name

ATP-sensitive inward rectifier potassium channel 8 (Inward rectifier K(+) channel Kir6.1) (Potassium channel, inwardly rectifying subfamily J member 8) (uKATP-1)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it (PubMed:20558321, PubMed:21836131, PubMed:24700710, PubMed:28842488). Their voltage dependence is regulate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	37 → 184	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	191 → 363	Inward rectifier potassium channel C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly detected in fetal and adult heart. {ECO:0000269|PubMed:9573340}.

Sequence

MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway		ATP sensitive Potassium channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypertrichotic osteochondrodysplasia Cantu type	Likely pathogenic	rs1366543712	RCV002287310	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Brugada syndrome	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada syndrome 1	Uncertain significance	ClinVar ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CANTU SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiac arrest	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cardiac arrhythmia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cardiovascular phenotype	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic cardiomyopathy	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KCNJ8-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUDDEN INFANT DEATH SYNDROME	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sudden unexplained death	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndromic disease	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amelogenesis imperfecta nephrocalcinosis	Amelogenesis Imperfecta	BEFREE	20558321, 22056721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29492846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29492846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	22562657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	22562657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	22562657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GENOMICS_ENGLAND_DG	27283775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	20558321, 22056721, 22840528	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada syndrome	Brugada Syndrome	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome (disorder)	Brugada Syndrome	CLINGEN_DG	11984590, 19120683, 20558321, 22056721, 22840528, 24367007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	20558321, 22056721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	ORPHANET_DG	22056721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome 1	Brugada Syndrome	CLINGEN_DG	11984590, 19120683, 20558321, 22056721, 22840528, 24367007		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cantu syndrome	Hypertrichotic osteochondrodysplasia	BEFREE	24176758, 24700710, 27247394, 29327300, 31175705, 31821173, 31828977		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cantu syndrome	Hypertrichotic osteochondrodysplasia	ORPHANET_DG	24176758, 24700710		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cantu syndrome	Hypertrichotic osteochondrodysplasia	UNIPROT_DG	24176758, 24700710, 28842488		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cantu syndrome	Cantu syndrome	Pubtator	24176758, 24700710, 29327300, 31175705, 31828977, 32100467, 34056838, 37527933	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cantu syndrome	Hypertrichotic osteochondrodysplasia	CTD_human_DG	28842488		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC CONDUCTION DEFECT, NONSPECIFIC (disorder)	Cardiac conduction disease	CLINGEN_DG	11984590, 19120683, 20558321, 22056721, 22840528, 24367007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37527933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24339868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24339868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33686948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33686948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33686948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19139106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Transient Neonatal 1	Diabetes mellitus transient neonatal	Pubtator	19139106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	19139106, 36097778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26631031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
First degree atrioventricular block	Atrioventricular block	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrichotic osteochondrodysplasia, Cantu type	Hypertrichotic Osteochondrodysplasia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21430528		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	18569028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	37527933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	37538797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26631031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular tachycardia	Paroxysmal ventricular tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Right bundle branch block	Bundle Branch Block	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21836131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	CLINGEN_DG	11984590, 19120683, 20558321, 22056721, 22840528, 24367007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	GENOMICS_ENGLAND_DG	27283775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trifascicular block	Trifascicular block	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24176758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	19120683, 24176758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation	Ventricular Fibrillation	CTD_human_DG	19120683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	24176758	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation	Ventricular Fibrillation	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	22825893		★★★★★ ★☆☆☆☆ Found in Text Mining only

KCNJ8 (potassium inwardly rectifying channel subfamily J member 8)